SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007507691.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007507691.1.35504
Domain Number 1 Region: 242-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000113
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 275-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000781
Family Classic zinc finger, C2H2 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007507691.1.35504
Sequence length 364
Comment PREDICTED: Krueppel-like factor 8 isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MTSSSLLELSSIETPTLLSEIKTEPPEELLAPDCGSVPQAEPVDLSLHKAKASPPQTAAL
LPSSMLVAPSVQPPVVSVSPSGLGSPSTSAIPAVLSPGSILASTQGSSGQQILHLIHTIP
SVSLPSKMGNLQTIPVVVQSLPVVYTTMAPDSVTAAITVPLIGGDGKNAGSVKLDPSSLS
PVEVQSDSEDSMGETVSVSAAFQELPRESVGTPLHHTDSPDLKKRRIHQCDFAGCNKVYT
KSSHLKAHRRIHTGEKPYKCTWEGCTWKFARSDELTRHFRKHTGIKPFHCSDCDRSFSRS
DHLALHRRRHIMMKLASSLGSFSKTEPQQWNPDDQLAATSGFLLLPTYLPMDSDAEKAPA
ASLL
Download sequence
Identical sequences F7FVX7
XP_007507687.1.35504 XP_007507688.1.35504 XP_007507689.1.35504 XP_007507690.1.35504 XP_007507691.1.35504 ENSMODP00000013625 ENSMODP00000013625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]