SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007661807.1.37387 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007661807.1.37387
Domain Number 1 Region: 164-285
Classification Level Classification E-value
Superfamily FKBP-like 1.14e-39
Family FKBP immunophilin/proline isomerase 0.0003
Further Details:      
 
Domain Number 2 Region: 47-159
Classification Level Classification E-value
Superfamily FKBP-like 2.36e-35
Family FKBP immunophilin/proline isomerase 0.00023
Further Details:      
 
Domain Number 3 Region: 265-376
Classification Level Classification E-value
Superfamily FKBP-like 1.1e-30
Family FKBP immunophilin/proline isomerase 0.00061
Further Details:      
 
Domain Number 4 Region: 395-460
Classification Level Classification E-value
Superfamily EF-hand 0.000000000267
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007661807.1.37387
Sequence length 474
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP10 isoform X1 [Ornithorhynchus anatinus]; AA=GCF_000002275.2; RF=representative genome; TAX=9258; STAX=9258; NAME=Ornithorhynchus anatinus; AL=Chromosome; RT=Major
Sequence
MSRPVPRPGPAGPSRRHLLLPPMLLPLVLLLRGPAGAGGRASPGALEDVVIDRYFVPKLC
PREVQIGDFIRYHYNGSFQDGRQFDSSYDRGATVAGVVGVGRLITGMDRGLQGMCVNERR
HLIVPPHLGYGSIGVAGLIPPDATLYFDVILLDIWNKEDKPQVTTLFRPPSCNRTVQDSD
FVRYHYNGTLLDGTHFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGVCIGEKRRITVPPHL
AYGENGAGDKIPGSAVLVFDVHVIDFHNPADPVEVQTLVRPESCNETSRLRDYVRYHYNC
SLMDGTRLFSSHDYGQPQEATLGANTVIEGLNTGLQGMCVGEQRRLVIPPHLGHGEHGAR
GVPGSAVLLFEVELVTLEEGLPEGYLFVWHGDPPGSLYQDMDRDQDGQIPLEEFSTFIKA
QVAEGKGRLLPGQDPDKTIGDMFRNQDRNQDGTITSAELKLKSDEDQERTHEEL
Download sequence
Identical sequences XP_007661807.1.37387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]