SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007766601.1.51617 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007766601.1.51617
Domain Number 1 Region: 16-63
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000242
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 71-113
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000222
Family Zn2/Cys6 DNA-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007766601.1.51617
Sequence length 395
Comment hypothetical protein CONPUDRAFT_135949 [Coniophora puteana RWD-64-598 SS2]; AA=GCF_000271625.1; RF=representative genome; TAX=741705; STAX=80637; NAME=Coniophora puteana RWD-64-598 SS2; strain=RWD-64-598 SS2; AL=Scaffold; RT=Major
Sequence
MRSHKGNIPVLPQTKLCPHCPAKFTRTTHLNRHLRTHTGERLHRCDTCEAQFTRSDLLTR
HKRSCGDPGHVSRTRRRSCQACAESKVKCDLQQPCGKCQDRGRECVFTMSGRTSRSPPSS
SLSIPSPAGETDDASSSRSEPGSRSRVSPTAPDDTISLPDYHQPPSPYDWSAGVSAGPSH
RTTDIHHVRTPQDPFSGAIPAQIHAQQLYSAEPLAIHRHSNPPPNDPYLYQHHSMYPDAS
YVQAPLTASTLPPEPRHYAPTSSDIRRHMSLPTLPHMPLHRNNDPFPPSEHYPGAEGGYG
DVYAHQSPQDYSHMRHYSSDTSGIVPPPQQMYRHHTPSPLSASSSPDFAFGSYGSSLPPT
EPMIQQGISNLRATQPNCPDCIMGIGRCVRGHLQG
Download sequence
Identical sequences jgi|Conpu1|135949|estExt_fgenesh1_pm.C_4_t10014 XP_007766601.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]