SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007767530.1.51617 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007767530.1.51617
Domain Number 1 Region: 6-108
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 5.23e-22
Family Barwin 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007767530.1.51617
Sequence length 109
Comment plant expansin [Coniophora puteana RWD-64-598 SS2]; AA=GCF_000271625.1; RF=representative genome; TAX=741705; STAX=80637; NAME=Coniophora puteana RWD-64-598 SS2; strain=RWD-64-598 SS2; AL=Scaffold; RT=Major
Sequence
MSGVQTGDATWYQTGLGACGVVNKNTDFIAAVSHSLFDTYPGYSDGNPNDNPVCGKKINM
HYGGKSVAVEVTDRCTGCATTSLDLSPSAFQHLASESAGRLHGMTWEWA
Download sequence
Identical sequences XP_007767530.1.51617 jgi|Conpu1|81561|fgenesh1_kg.5_#_108_#_isotig11816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]