SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007767739.1.51617 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007767739.1.51617
Domain Number 1 Region: 19-137
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 1.95e-23
Family Barwin 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007767739.1.51617
Sequence length 137
Comment plant expansin [Coniophora puteana RWD-64-598 SS2]; AA=GCF_000271625.1; RF=representative genome; TAX=741705; STAX=80637; NAME=Coniophora puteana RWD-64-598 SS2; strain=RWD-64-598 SS2; AL=Scaffold; RT=Major
Sequence
MFFSKALVFATLAVAGASAAVIEKRQSYLTGTQTGEGTSYAVGTGACGVHNVPSDLIVAV
SQQLFDTYPGYKGGNPNNNPVCGKKIKANYQGKSVTVTVEDRCTGCALTDLDFSTGAFEQ
LAPLSVGRLHGMTWTWV
Download sequence
Identical sequences jgi|Conpu1|143507|estExt_fgenesh1_pg.C_5_t10167 XP_007767739.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]