SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007846726.1.35326 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007846726.1.35326
Domain Number 1 Region: 3-184,211-290
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.49e-81
Family Capz beta-1 subunit 0.0000000962
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007846726.1.35326
Sequence length 294
Comment f-actin capping protein beta subunit [Moniliophthora roreri MCA 2997]; AA=GCF_000488995.1; RF=representative genome; TAX=1381753; STAX=221103; NAME=Moniliophthora roreri MCA 2997; AL=Contig; RT=Major
Sequence
MADVVDSMLDLMRRLPPTRTEENVQALIGICPDYADDLLGSVDQPLQLKVDRATGREYLA
CDYNRDGESYRSPWSNEYDPPLEDGTIPTPKLRKLEISANEAFDTYREMYYEGGVSSVYL
WDLEDGGFAGVVLLKKTMTPGSPSEPSGSWDSIHVFETAERGRQAHYKLTSTIMLQLITK
KSSDGDADANDKKFDTNESDKKLLDGWKRDGEVTLSGSMTRQTEQDWPLHDTSSHITNTG
KMIEEMEIKMRNLLQEVYFGKTRDIIYDLRSVEDLEKTRRQRELQKELVGFIKR
Download sequence
Identical sequences A0A0W0EUT4 V2YQK5
XP_007846726.1.35326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]