SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007871443.1.11637 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_007871443.1.11637
Domain Number - Region: 309-343
Classification Level Classification E-value
Superfamily CinA-like 0.0981
Family CinA-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007871443.1.11637
Sequence length 519
Comment purine-cytosine permease [Gloeophyllum trabeum ATCC 11539]; AA=GCF_000344685.1; RF=representative genome; TAX=670483; STAX=104355; NAME=Gloeophyllum trabeum ATCC 11539; strain=ATCC 11539; AL=Scaffold; RT=Major
Sequence
MADLYPDKEKAASSSDGGVAVTEAHIEERAPETVIVQRFGRFGGWMAKLFDHGVEARGIE
RVPEDERESKNVWNNLLMWWSVNTVLTTIPIGVLAQEFYTLTFPHAVATIMCFGALGGVC
TAFIATLGPQTGLRTMVITRFSSGYVGGTIYSILNILTQLGFSTTAVILGGQTLASINPG
TLPLVVGIIIIGLCSLVPCFIGYNMVHIYERYAWIVTFIVMLFLWGLGGRAGFDIGAQKG
LEDHGRALSADVLSFGGIVFGSFTGWAPVAADYNCRLPVSTPPLKVFLLTFFGLFIPICF
VEILGAALMTITDPAYTSAFAEGSTGGLLGQVLSPWKGGGKFVLVLLALSVVANNIPNTY
STALSIQALARPFALIPRFVWTLLAFAIYTIAGVAGREHFSEILSNFLSILSYWTAFFIV
IVAEEHLIFRRRGGPLGGYNLADYDTPGRLPLGVAGILAGCFGVAGAVVGMSEVWYTGPL
GRDAGTELYGADLGFELAAGFAAVTFLPLRYLEIRLTGR
Download sequence
Identical sequences S7PRU9
jgi|Glotr1_1|141628|estExt_Genemark1.C_000650002 XP_007871443.1.11637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]