SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007882018.1.23263 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007882018.1.23263
Domain Number 1 Region: 3-154,275-419
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.13e-69
Family Capz alpha-1 subunit 0.0000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007882018.1.23263
Sequence length 425
Comment hypothetical protein PFL1_06286 [Anthracocystis flocculosa PF-1]; AA=GCF_000417875.1; RF=representative genome; TAX=1277687; STAX=84751; NAME=Anthracocystis flocculosa PF-1; strain=PF-1; AL=Scaffold; RT=Major
Sequence
MPSDRLSAAARLLVQAPPGQVSQVYHDLRGILLDPEAGADDGQTIDDAQIKHMALVALEE
YNTSQLIPVAIDEAAKDHVIICQAAQIPSSTDTATKRYAHPRAKKSFAFDHMARTASDIQ
DLPVDEDAEPLRAALDAALQNYVADRYNSGVSSVFAVSNVPYKPAAPTAAASSDAQQQQH
EEAAKVDAEDPAVPTAAAAANEDAETEGAEKKGDGSPNQEGDATAADDDGDNVKDDPVEA
AAASEAVSSDSTSPTAAAAEEARDASEQQQPQEQEPETTPRQIKYTFHHVGNKYHLSNFW
SGRWRASYTLDVEAATLTSSLQVQVHYFENGNVQLNASKPKTFHLDQSSLAGEGSESEHV
KRVAEHVVKLVERHEDDYQSLLEETYEDLGEKAFKALRRQLPLTKNKIDWNQLMNYRLGA
ELARQ
Download sequence
Identical sequences A0A061H1C6
XP_007882018.1.23263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]