SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007892738.1.63211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007892738.1.63211
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-55
Family YWTD domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 180-426
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-51
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 3 Region: 784-1045
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-40
Family YWTD domain 0.0000432
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-28
Family YWTD domain 0.0000476
Further Details:      
 
Domain Number 5 Region: 1174-1212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 738-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000105
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 7 Region: 1095-1135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000154
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 8 Region: 1136-1172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 436-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 10 Region: 132-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000346
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 11 Region: 1054-1105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000733
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007892738.1.63211
Sequence length 1458
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X2 [Callorhinchus milii]; AA=GCF_000165045.1; RF=representative genome; TAX=7868; STAX=7868; NAME=Callorhinchus milii; AL=Scaffold; RT=Major
Sequence
MYWTDWGEVPKIERAGMDGTTRSVIIDNNIYWPNGLTLDYEDEKLYWADAKLSFIHRSDF
DGTFRQVVVEGSLPHPFALTLFGDTLYWTDWNTHSIHACNKYTGQERREVHSNIFSPMDI
HVFNQQRQPNATNPCGTSNGGCSHLCLMSPIKPFYRCACPTGVQLLKDGTTCKDGASELL
LLARRTDLRRISLDTPDFTDVVLQLDDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSYLDG
SASQFVVTSQINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLDEPRAI
VLDPMSGYMYWTDWGEIPKIERASLDGTDRVVLVNTSLGWPNGLALDYEERKMYWGDAKT
DKIEVMNCDGTGRHVLVEDKLPHIFGFTLLGDYIYWTDWQRRSIERVQKRSAEREIIIDQ
LPDLMGLKATGVHRILGTNPCADDNGGCSHLCLYRPQGVRCACPIGLELIRDMKTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVARLDGQHRQVLVWKDLDSPR
ALALDPAEGFMYWTEWGGKPKIDRAAMDGTGRITLVPNVGRANGLTIDYAERRLYWTDLD
TSLIESSNMLGLDREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG
HLDYVMDILVFHSSRQGGWNECASSNGHCSHLCLAVPNVGYVCGCPAHFYLNTDNKTCSP
PTSFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPVHKHLYWIDSRQNVIRR
AQEDGTESFTVVTSTIPNQNLDMQPYDLSIDVYSRYIYWTCEATNVINVTRLDGKPIGVV
LRGEQDKPRAIIVNPERGYMYFTNLQDRSPRIERAALDGTEREVLFFSGLSKPVALAIDN
KIGKLFWADSDLRRIESSDLSGANRIVLEDANILQPVGLTVFGSHLYWIDRQQQMIERIE
KMNGNSRTKIQARIAQLSDIHAVKDLDLEEFAEHPCTQDNGGCSHICIVKGDGTTRCSCP
VHLVLLQDELSCGEPPTCAPDHFTCATGEIDCIPLAWRCDGYPECDDQSDEQNCPVCSDS
QFQCASGQCIEVAFRCNGETNCQDQSDEQKCEVLCPVDQFRCANGQCIAKHKKCDHNNDC
TDNSDEVACYPTEEPTPQPTNTIGSIIGVILSVFVIGAMYFICQRVLCPRMKGDGETMTN
DFVVHGSASVPLGYVPHTNSLPGSLQGMSRGKSVMSSLSIMGGSSGPPYDRAHVTGASSS
SSSSTKGTYFPPMLNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYAYRNFAPPTTP
CSTDVCDSDYTPGRRMAMTKCYSDLNYDSEPFPPPPTPRSQYLSAEENYESCPPSPYTER
SYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_007892738.1.63211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]