SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007924385.1.3604 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007924385.1.3604
Domain Number 1 Region: 8-154
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 3.9e-20
Family Deoxycytidylate deaminase-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007924385.1.3604
Sequence length 176
Comment hypothetical protein MYCFIDRAFT_83140 [Pseudocercospora fijiensis CIRAD86]; AA=GCF_000340215.1; RF=representative genome; TAX=383855; STAX=1873960; NAME=Pseudocercospora fijiensis CIRAD86; strain=CIRAD86; AL=Scaffold; RT=Major
Sequence
MSAPDSINHLHYLRLALNEARRSPPKPTNFCVGALLLAPSQSREPLITGYTLECKGNTHA
EQSCFIKLGEKYGCEDTDLGRNLPEDTILYTTMEPCNQRSVGNLPCVDRILALKRRDGTP
AIRFVVCGVSEPETFVGLNEGKRKLRDAGIEVVAVAGMEEDILAVATAGHLKEGAS
Download sequence
Identical sequences M2Z5P4
XP_007924385.1.3604 jgi|Mycfi1|83140|fgenesh1_pg.C_scaffold_17000336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]