SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007940538.1.48129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007940538.1.48129
Domain Number 1 Region: 56-240
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.18e-68
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 256-377
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-34
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 3 Region: 562-702
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-29
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 4 Region: 971-1125
Classification Level Classification E-value
Superfamily Spectrin repeat 8.77e-28
Family Spectrin repeat 0.00000288
Further Details:      
 
Domain Number 5 Region: 1812-1966
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-27
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 6 Region: 1493-1648
Classification Level Classification E-value
Superfamily Spectrin repeat 1.9e-27
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 776-911
Classification Level Classification E-value
Superfamily Spectrin repeat 4.2e-25
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 8 Region: 1190-1336
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-24
Family Spectrin repeat 0.00067
Further Details:      
 
Domain Number 9 Region: 386-487
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-22
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 10 Region: 1651-1758
Classification Level Classification E-value
Superfamily Spectrin repeat 9.84e-22
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 11 Region: 706-810
Classification Level Classification E-value
Superfamily Spectrin repeat 1.76e-19
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 12 Region: 490-597
Classification Level Classification E-value
Superfamily Spectrin repeat 2.02e-18
Family Spectrin repeat 0.00065
Further Details:      
 
Domain Number 13 Region: 1347-1443
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000523
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 14 Region: 1972-2031
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000677
Family Spectrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007940538.1.48129
Sequence length 2099
Comment PREDICTED: spectrin beta chain, erythrocytic [Orycteropus afer afer]; AA=GCF_000298275.1; RF=representative genome; TAX=1230840; STAX=9818; NAME=Orycteropus afer afer; AL=Scaffold; RT=Major
Sequence
MTSATEFENEGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALAAKLEEQPRKLV
EPKPTKGKMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQI
QDIVVQTQEGRETRSAKDALLLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDL
IDFDKLKDSNARHNLEHAFDVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSK
MKVLAVEGKRVGKVIDHAIETEKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQ
QLQAFSTYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESL
EEAEYRRELALRNELIRQEKLEQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEA
AKKKHEAIETDTAAYEERVRALEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLRA
RRQRLEMTLALQKLFQDMLHSINWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAI
QGDKVKAITTATLQFTEGQGYQPCDPQVIQDRVSHLEQCFAELSNMAAGRKAQLEQSKRL
WKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDTHLEQIFQE
AEGMVARKQFGHPQIEARIKEVSAQWNQLKELAAFRKKNLQDAETFFQFQGDADDLKAWL
QDAHRLLSGEDVGQDEGATRALGKKHKDFLEELEESRGVMEHLEQQAQGFPQEFRDSPDV
TNRLQTLRELYQQVVAQADLRRQRLQDALDLYTVFGETDACELWMGEKEKWLAQMEIPDT
LEDLEVVQHRFDILDQEMKTLMTQIDGVNLAANSLVESGHPRSGEVKQYQDHLNTRWQAF
KIMVSERREAVDSALRVHNYCVDCEETSKWILDKTKVVESTKDLGRDLAGVIAIQRKLSG
LERDVAAIQARVGALERESRRLMESHPELKEDIGRRQAYVEELWQGLQRALQGQEASLGE
ASQLQAFLQDLDDFQAWLSMAQKAVASEDMPESLPEAEQLLQQHAAIKDEIDGHQESYQH
VKASGEKVIHGQTDPEYLLLGQRLEGLDTGWDALRRMWESRGRSLAQCLGFQEFQKDAKQ
AETILSNQEYTLAHLEPPDSLEAAEAGIRKFEDFLMSMENNRDKVLNPVDSGNKLVAEGN
LYSEKIKEKVQLIEDRHRKNNEKAEEASVLLRDNLELQNFLQNCQELTLWINDKLLTSQD
VSYDESRNLHNKWLKHQAFVAELASHQGWLENIDAEGKQLMEEKPQFATIVSQKLDALHR
LWDELQATTQEKAKQLSAARSSDLRSQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLA
KLKALEDQVNVRKEELEQLFAQVPSLGEEAEDTDVSIEKRFLDLLEPLGRRKKQLESSRA
KLQISRDLEDETLWVEERLPLAQSADYGINLQTVQLFMKKNQTLQNEIVGHTPRIEAVLQ
RGYQLVETPEVDWGDIEERLRHLQDSWDTLREAAAARLQRLRDANEAQQYYLDAGEAEAW
ISEQELYVISDETPKDEEGAIVMLKRHLRQQRSVEEYGRNIKQLASRAQSLLSAGHPEGE
QIIRLQGQVDKQYAGLKDMAEERKRKLENMYHLFQLKREADDLEQWIAEKDLVASSPEMG
QDFDHVTLLRDKFRDFARETGAIGQERVDNVNAIIERLIDTGHGEAATIAEWKDGLNEMW
ADLLELIDTRMQLLAASYDLHRYFYTGAEILGLIDEKHRELPEEVGLDASTAESFHRVHT
AFERELHLLGVQVQQFQDVATRLQTAYAGEKADDIQNKEQEVSAAWQALLDACAGRRTQL
VDTADKFRFFSMVRDLLSWMESIIRQIETQERPRDVSSVELLMKYHQGIRAEIETRSKNF
SACLELGESLLQRQHQASDEISEKLRQVVSRRKEMNEKWEARWQRLSMLLEVCQFSRDAS
VAEAWLIAQEPYLASQDFGHTVDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKER
QPPETITEETGAQEEEGETAGEAPGVSHQAATERTSPVSFLSRLSSSWESLLPEPAHPY
Download sequence
Identical sequences XP_007940538.1.48129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]