SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007975657.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007975657.1.81039
Domain Number 1 Region: 103-195
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000036
Family Spectrin repeat 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007975657.1.81039
Sequence length 211
Comment PREDICTED: suppressor of IKBKE 1 isoform X1 [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPDQVRQRYQE
DASDMKDMSKYKPHILLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLM
VAKKAVDAEPVLKAHQSHSAEIESQIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELE
NKELRELLSISSESLQARKENSMDTASQAIK
Download sequence
Identical sequences A0A2K5KK82 A0A2K5YWW9 H2PZQ8
ENSP00000358541 NP_001095866.1.87134 NP_001095866.1.92137 XP_007975657.1.81039 XP_008971788.1.60992 XP_009426920.1.37143 XP_011856201.1.47321 XP_011938655.1.92194 gi|156151379|ref|NP_001095866.1| ENSPANP00000000822 ENSPTRP00000001959 ENSP00000060969 ENSPTRP00000001959 9598.ENSPTRP00000001959 9606.ENSP00000358541 ENSP00000358541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]