SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007979847.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007979847.1.81039
Domain Number 1 Region: 2-126
Classification Level Classification E-value
Superfamily FKBP-like 1.77e-39
Family FKBP immunophilin/proline isomerase 0.00041
Further Details:      
 
Domain Number 2 Region: 129-241
Classification Level Classification E-value
Superfamily FKBP-like 3.14e-37
Family FKBP immunophilin/proline isomerase 0.00029
Further Details:      
 
Domain Number 3 Region: 235-340
Classification Level Classification E-value
Superfamily FKBP-like 8.05e-34
Family FKBP immunophilin/proline isomerase 0.00037
Further Details:      
 
Domain Number 4 Region: 346-421
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000366
Family Calbindin D9K 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007979847.1.81039
Sequence length 432
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP9 isoform X2 [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MDIWNSEDQVQIHTYFKPPSCPRTIQVSDFVRYHYNGTFLDGTLFDSSHNRMKTYDTYVG
IGWLIPGMDKGLLGMCVGEKRIITIPPFLAYGEDGDGKDIPGQASLVFDVALLDLHNPKD
SISIENKVVPENCERISQSGDFLRYHYNGTLLDGTLFDSSYSRNRTFDTYIGQGYVIPGM
DEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAVLVFDIHVIDFHNPSDSISITSHYK
PPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKTYNIVLGSGQVVLGMDMGLREMCV
GEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVAGLPEGYMFIWNGEVSPNLFE
EIDKDGNGEVLLEEFSEYIHAQVASGKGKLAPGFDAELVVKNMFTNQDRNGDGKVTAEEF
KLKDQEAKHDEL
Download sequence
Identical sequences XP_007979847.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]