SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007985166.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007985166.1.81039
Domain Number 1 Region: 29-277
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.06e-91
Family Calponin-homology domain, CH-domain 0.00000315
Further Details:      
 
Domain Number 2 Region: 2170-2291
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-34
Family Pleckstrin-homology domain (PH domain) 0.0000189
Further Details:      
 
Domain Number 3 Region: 293-414
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-34
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 4 Region: 1640-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 8.76e-29
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 1532-1687
Classification Level Classification E-value
Superfamily Spectrin repeat 5.7e-28
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 1010-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 1.75e-27
Family Spectrin repeat 0.0000014
Further Details:      
 
Domain Number 7 Region: 1851-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 3.34e-27
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 8 Region: 815-950
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-25
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 9 Region: 1228-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-24
Family Spectrin repeat 0.00077
Further Details:      
 
Domain Number 10 Region: 599-719
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-23
Family Spectrin repeat 0.00088
Further Details:      
 
Domain Number 11 Region: 423-524
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-22
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 12 Region: 738-854
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-20
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 13 Region: 527-634
Classification Level Classification E-value
Superfamily Spectrin repeat 1.12e-18
Family Spectrin repeat 0.00061
Further Details:      
 
Domain Number 14 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000173
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 15 Region: 1386-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000012
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007985166.1.81039
Sequence length 2328
Comment PREDICTED: spectrin beta chain, erythrocytic [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MTSAAEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDVVDGNHRLVLGLIWTIILRFQIQDIVVPTQEGRETAKDALLLW
CQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDVAE
RQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIETEK
MIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKGNL
EVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIRQEKLEQ
LARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRALE
DLAQELEKENYHDQKRITARKDNILRLWSYLQELLRSRRQRLETTLALQKLFQDMLHSID
WMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLKFTEGKGYQP
CDPQVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMNEAESWIKEKEQIYSS
LDCGKDLTSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKEVG
DAAQWDQLKELAAFRKKNLQDAENFFQFQGDADDLKVWLQDAHRLLSGEDVGQDEGATRA
LGKKHKDFLEELEESRGVMEHLEQQAQGFPEEFRDSPDVTHRLQALRELYQQVVAQADLR
QQRLQEALDLYTVFGETDACELWMGEKEKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTL
MTQIDGVNLAANSLVESGHPRSGEVKQYQDHLNTRWQAFQTLVSKRREAVDSALRVHNYC
VDCEETSKWITDKTKVVESTKDLGRDLAGVIAIQRKLSGLERDVAAIQARVDALERESQQ
LMDSHPEQKEDIGQRQKHLEELWQGLQQALRGQEDLLGEVSQLQAFLQDLDDFQAWLSIT
QKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDSYQRVKESGEKVIQGQTDPEYLLLG
QRLEGLDTGWDALDRMWESRSHTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSL
EAAEAGIRKFEDFLGSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHRKNN
EKAEEASVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVA
ELASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALHRLWDELQATTKEKTQHLSAARS
SDLRLQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELGELFA
QVPSTGEEAGDVDLSIEKRFLDLLEPLGRRKKQLESSRAKLQINRDVEDETLWVEERLPL
AQSADYGTNLQTVQLFMKKNQTLQNEILGHTPRVEDVLQRGQQLVEAAEIDCQDLEERLR
HLKSSWDRLQEAAAGRLQRLRDANEAQQYYLDADEAEAWIGEQELYVISDEIPKDEEGAI
VMLKRHLRQQRAVEDYGRNIKQLASRAQGLLSAGHPEGEQIIRLQGQVDKHYAGLKDVAE
ERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDHVTLLRDKFRDFARETG
AIGQERVDNMNAFIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLH
RYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVAT
RLQTAYAGEKAEAIQNKEQEVSAMWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWME
SIIRQIETQERPRDVSSVELLMKYHQGINAEIETRSKNFSACLELGESLLQRQHQASEEI
REKLQQVMSRRKEMNEKWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHT
VDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQIAERPAEETGPQEEEGETAG
EAPVSHHAATERTSPGEEQGTWPQNLQQPPPPGQHEDGQKSAGDERPATEPLFKVLDTPL
SEGDEPATLLAPRDHGHSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSELTFYKD
AKNLALGMPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEMLSWL
QGVSTAINESQSIRVKAQSLPLPSLSGPDPSLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences XP_007985166.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]