SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008016535.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_008016535.1.81039
Domain Number - Region: 109-166
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00157
Family VPS37 C-terminal domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008016535.1.81039
Sequence length 251
Comment PREDICTED: vacuolar protein sorting-associated protein 37D [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MYRARAARAGPEPGSPGRFGILSTGQLRDLLQDEPKLDRIVRLSRKFQGLQLEREACLAS
NYALAKENLALRPRLEMGRAALAIKYQELREVAENCADKLQRLEESMHRWSPHCALGWLQ
AELEEAEQEAEEQMEQLLLGEQSLEAFLPAFQRGRALAHLRRTQAEKLQELLRRRERSAQ
PAPTSAADPPKSFPAAAVLPTGAARGPPAVPRSLPPLDSRPVPPLKGSPGCPLGPAPLLS
PRPSQPEPPHR
Download sequence
Identical sequences A0A096N4K3 A0A0D9S005 A0A2I3SYZ7 A0A2J8XV00 A0A2K5RYC7 G3QGH6 I0FPI3 Q86XT2
9606.ENSP00000320416 ENSPTRP00000032946 ENSP00000320416 ENSP00000461461 ENSPTRP00000032946 ENSPANP00000007321 NP_001071089.1.87134 NP_001071089.1.92137 XP_004045609.1.27298 XP_008016535.1.81039 XP_009451595.1.37143 XP_014988810.1.72884 XP_016800781.1.37143 XP_017388913.1.71028 ENSGGOP00000001434 ENSGGOP00000001434 gi|117938318|ref|NP_001071089.1| ENSP00000320416 ENSP00000458873 ENSP00000320416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]