SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008023574.1.61199 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008023574.1.61199
Domain Number 1 Region: 2-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.05e-84
Family Capz beta-1 subunit 0.0000000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008023574.1.61199
Sequence length 265
Comment hypothetical protein SETTUDRAFT_168156 [Setosphaeria turcica Et28A]; AA=GCF_000359705.1; RF=representative genome; TAX=671987; STAX=93612; NAME=Setosphaeria turcica Et28A; strain=Et28A; AL=Scaffold; RT=Major
Sequence
MADPIDSALDLLRRLDPKDVKRNVDHIIQLNPSLEEDLLESVDIPLTVKKCSKTKRDFLC
CDYNRDGDSWRSPWSNEFEPPIDEGVTPSDRVRKMEVKANEAFDVYRELYFEGGISSVYL
WDMDDGFAGCVLLKKAVSPTPKSSGSWDSIHVFDAQDRARTSHYKLTSTVILSLGTDSES
LGGLDLSGNMVRQVEADMAVEDDTSHVANIGKMVEDMELKMRNLLQEVYFGKAKDVVGDL
RSLQSLSQANKDRATQREMINSMGR
Download sequence
Identical sequences R0IVX8
jgi|Settu1|168156|fgenesh1_kg.14_#_191_#_isotig07578 XP_008023574.1.61199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]