SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008059586.1.4292 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008059586.1.4292
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-55
Family YWTD domain 0.00000581
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 1.09e-50
Family YWTD domain 0.00000259
Further Details:      
 
Domain Number 3 Region: 782-1040
Classification Level Classification E-value
Superfamily YWTD domain 9.29e-38
Family YWTD domain 0.000076
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-27
Family YWTD domain 0.0000799
Further Details:      
 
Domain Number 5 Region: 1171-1207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 1133-1169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1093-1131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000105
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 9 Region: 739-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family EGF-type module 0.026
Further Details:      
 
Domain Number 10 Region: 135-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000158
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1050-1102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000115
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008059586.1.4292
Sequence length 1451
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Carlito syrichta]; AA=GCF_000164805.1; RF=representative genome; TAX=1868482; STAX=1868482; NAME=Carlito syrichta; AL=Scaffold; RT=Major
Sequence
MYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKQTGGKRREILSALYSPMDI
QVLSHERQPSFHTRCEEDNGGCSHLCLLSPREPFYACACPTGVQLRDNGKTCKAGAEEVL
LLARRTDLRRISLDTPDFTDIVLQVEDVRHAIAVDYDPLEGHVYWTDDEVRAIRRARLDG
SGAQTLVSTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEGLDEPRAI
VLHPVMGLMYWTDWGESPKIECAHLDGQERRVLVNVSLGWPNGLALDLQDGKLYWGDAKT
DKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQ
LPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPRATRCGCPIGLELLSDSKTCIVPE
AFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVANNHIYWTDVSLKTISRAYM
NGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGRFRQVLVWRDLDNPR
SLALDPTKGFIYWTEWGGKPRIVRAFMDGTSCMTLVDKVGRANDLTIDYADRRLYWTDLD
TNMIESSNMLGQERAVIADDLPHPFGLTQYGDYIYWTDWHLHSIERADKTSGRNRTLIQG
QLDFVMDILVFHASRQDGLNDCTHSNGQCGQLCLAVPGGHRCGCASHYTLDPSGRNCSPP
TAFLLFSQKCAISRMIPDDPHSPDLVLPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAR
DDGTQPFVLTSPGQGQNPDRQPHDLSLDIYSRTLFWTCEATDTINVHRLGGDAMGVVLRG
DRDKPRAIVVNAERGYLYFTNMQDRAARIERAALDGTEREVLFTTGLIRPVALVVDNTLG
KLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLTVLGRHLYWIDRQQQMIERVDKTT
GDKRMRVQGRVAHLTGLHAVEEVSLEDFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHL
VLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFP
CARGQCVDLRLRCDGEADCQDRSDEADCDAVCLPNQFRCASGQCVLIKQQCDAFPDCIDG
SDELMCEITKPPADDAPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGASGSFPH
EYVSGTPHVPLDFLAPGGSQHGPFPGIACGKSMMSSVSLVGGRGGMPLYDRNHVTGASSS
SSSSTKATLYPPILNPPPSPATDPSLYNVDVFYPSNIPASARPYRPYITRAGAPPTTPCS
TDVCDSDYSASRWKASKYYLDLNSDSDPYAPPPTPHSQYLSAEDSCPPSPATERSYFHLF
PPPPSPCTDSS
Download sequence
Identical sequences A0A1U7U108
XP_008059586.1.4292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]