SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008109576.1.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008109576.1.98722
Domain Number 1 Region: 632-887
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-55
Family YWTD domain 0.00000321
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-55
Family YWTD domain 0.00000142
Further Details:      
 
Domain Number 3 Region: 331-566
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-50
Family YWTD domain 0.00000326
Further Details:      
 
Domain Number 4 Region: 935-1195
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-39
Family YWTD domain 0.0000341
Further Details:      
 
Domain Number 5 Region: 889-937
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000745
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 1326-1364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1248-1286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 587-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000652
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 1288-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000877
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 283-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 11 Region: 1204-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000311
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008109576.1.98722
Sequence length 1614
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MGAVLRSLLVCGLCSLTRASPLLLYANRRDLRLVDAAQVNENATVVVSGLEDAAAVDFIF
IHGLIYWSDVSEEAIKRTEFNKTGNVQNVVISGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGSTRSIIITAD
IYWPNGLTLDYEDQKLYWADAKLNFIHRSNLDGTHREAVIKGSLPHPFALTLFGDTLYWT
DWTTRAVLACNKYTGENLREIHSNIFSPMDIHVFNQQRQPNATNPCGTNNGGCSHLCLMS
PVKPSYQCACPTGVKLLENEKTCKDGAMELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSASQFVVQAQIAHPDGIAVDWIARNLYWT
DTGTDRIEVTRLNGTMRKILISEELEEPRAIVLDPMVGYMYWTDWGEIPKIERATLDGSD
RVVLVNTSLGWPNGLALDYVEHKIYWGDAKTDKIEVMNADGTNRRVLVEDKLPHIFGFTL
LGDYIYWTDWQRRSIERVHKRTAEREIIIDQLPDLMGLKATNVHQITGTNPCAELNGGCS
HLCLYRPQGLRCACPIGLELINDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERSTLVPNVGRANGLTIDYVKRRLYWTDLDTNLIESSNMLGLDRDVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQNHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNSDNKTCSAPTSFLLFSQKNAINRMVIDELQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNVIRRSQEDGSQSFTVVMSPVPNQNLDIQPYDLS
IDIYSRYIYWTCEANNVINVTRLDGRPMGVVLKSDQDRPRAIVVNPEKGYMYFTNLQERS
PPKIERAALDGTEREVLFSNGLSKPVALAVDSQLGKLFWADSDLRRIESSDLSGANRIVL
EDSNILQPIGLTVFENWLYWIDRHQQMIEKIDMTRQDRRTKVQARIAQLSDIHAVKELNM
QEYKLHPCSQDNGGCSHICIVKGDGTTRCSCPIHLVLLQDELSCGEPPTCSPQHFTCFTG
EIDCIPVAWRCDGFTECEDASDEKNCPVCSESQFQCDSGQCIDSALQCNGEPNCQDSSDE
KKCEVLCLTDQFRCSSGQCIGKNKKCDQNLDCSDNSDEQGCYTTEEPAPQASSTIGSVVG
VILTLFVVTAMYFVCQRVLCPRMKGEGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGM
PRGKSVISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYT
MEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVMTTTVGKGYTSD
LNYDSEPVPPPPTPRSQYLSAEENYESCPPSPFTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences G1KD13
XP_008109576.1.98722 ENSACAP00000004540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]