SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008137172.1.99482 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008137172.1.99482
Domain Number 1 Region: 29-280
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.36e-92
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 296-417
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-34
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 3 Region: 2176-2295
Classification Level Classification E-value
Superfamily PH domain-like 9.04e-34
Family Pleckstrin-homology domain (PH domain) 0.0000189
Further Details:      
 
Domain Number 4 Region: 602-742
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-29
Family Spectrin repeat 0.00028
Further Details:      
 
Domain Number 5 Region: 1641-1794
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-29
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 6 Region: 1533-1687
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-28
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 7 Region: 1852-2006
Classification Level Classification E-value
Superfamily Spectrin repeat 6.04e-27
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 8 Region: 1011-1165
Classification Level Classification E-value
Superfamily Spectrin repeat 6.89e-27
Family Spectrin repeat 0.00000398
Further Details:      
 
Domain Number 9 Region: 816-950
Classification Level Classification E-value
Superfamily Spectrin repeat 8.88e-26
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 10 Region: 1230-1376
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-25
Family Spectrin repeat 0.00058
Further Details:      
 
Domain Number 11 Region: 426-527
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-22
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 12 Region: 746-850
Classification Level Classification E-value
Superfamily Spectrin repeat 3.52e-19
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 13 Region: 530-637
Classification Level Classification E-value
Superfamily Spectrin repeat 5.33e-19
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 14 Region: 1985-2071
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000157
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 15 Region: 1388-1483
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000484
Family Spectrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008137172.1.99482
Sequence length 2332
Comment PREDICTED: spectrin beta chain, erythrocytic isoform X1 [Eptesicus fuscus]; AA=GCF_000308155.1; RF=representative genome; TAX=29078; STAX=29078; NAME=Eptesicus fuscus; AL=Scaffold; RT=Major
Sequence
MTSATEFENVANQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARKSCRITDLYKDLRDGQMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVPEGPEGRETRSAKDAL
LLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFD
VAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRIGKVIDHAIE
TEKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEK
GNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIRQEK
LEQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYKERVQ
ALEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLASRRQRLETTLALQKLFQDMLH
SIDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAINTATLQFTEGQG
YQPCDPQVIRDRVSHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQI
YSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLDQIFREAEGMVARKQFGHPQIEARIK
EVSAQWDQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHKLLSGEDVGQDEGATR
ALGKKHKDFLEELEESRAVMEHLERQAQGFPQEFRDSPDVTNRLQALRDLYQQVVAQADL
RRQKLQDALDLYTVFGETDACELWMGEKEKWLAQMEIPDTLEDLEVVQHRFDILDQEMKT
LMTQIDGVNLAANSLVESGHPRSGEVKQYQDHLNTRWQAFQTMVSDRREAVGSALRVHNY
CVDCEETSKWIQDKTKVVESTKDLGRDLTGVIAIQRKLSGLERDVAAIQARVGALERESQ
RLMESHPELKEDIGRRQAYVEELWQGLQRALQGQEASLGEASQLQAFLQDLDNFQGWLAM
AQKAVASEDTPESLPEAEQLLQQHAAIKDEIEGHQDSYERVKASGEKVLHGQTDPEYLLL
GQRLEGLGTGWDDLRRMWESRSHFLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLETPDS
LEAAEAGIRKFEDFLVSMENNQDKVLSPVDSGNKLVAEGNLYSDKIKEKVQSIEDRHRKN
NEKAQEASLLLKDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFM
AELASHQGWLDSIDAEGKQLMEEKPQFAALVSQRLEALHRLWDELQATTKEKAQQLSAAR
SSDLRSKTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELGELF
AQMPSLDEEEGGADMSIEKRFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLP
LAQSSDYGINLQTVQLFMKKNQTLQNEILGHAPRVEDVLQRGQRLVEEAEIDCGDIEERL
GHLQSSWDTLREAAAGRLQRLRDASEAQQYYLDAGEAEAWISEQELYVISDEIPKDEEGA
IVMLKRHLRQQRAVEEYGRNIKQLAGRAQVLLAAGHPEGEQIIRLQGQVDKQYAGLKDMA
EERKRKLENMYHLFQLKREADDLEQWIAEKELVASSPEMGQDFDHVTLLRDKFRDFARET
GAIGQERVDNVNAIIERLIDAGHGEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDL
HRYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGQQVQQFQDVA
TRLQMAYAGEKADAIQDKEREVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWM
ESIIRQIETQERPRDVSSVELLMKYHQGIRAEIETRSKNFNACLELGESLLQREHQASEE
IREKLQQVMSRRKEMNEKWEARWERLSMLLEVCQFSRDASVAEAWLIAQEPYLASRDFGH
TVDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQIPETPVEETGPQEEEGETA
GEGPRGPHRAATERTSPGEEERQWPQDLQPPPPPGPQKEGQEEKSGGDERPATEPLLKAL
DTPLSEGDEPTTLPAQRDHGHSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSELT
FYKDAKNLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEM
LSWLQGVSTAINESQSIRVKAQSLPLSSITGPDTSLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences XP_008137172.1.99482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]