SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008139078.1.99482 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008139078.1.99482
Domain Number 1 Region: 572-827
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-56
Family YWTD domain 0.00000326
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-55
Family YWTD domain 0.00000144
Further Details:      
 
Domain Number 3 Region: 331-519
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-39
Family YWTD domain 0.00000937
Further Details:      
 
Domain Number 4 Region: 875-1134
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-39
Family YWTD domain 0.0000427
Further Details:      
 
Domain Number 5 Region: 829-876
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000628
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1265-1303
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 1186-1226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 528-574
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000199
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 9 Region: 1227-1263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 283-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000658
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1144-1197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000306
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008139078.1.99482
Sequence length 1553
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Eptesicus fuscus]; AA=GCF_000308155.1; RF=representative genome; TAX=29078; STAX=29078; NAME=Eptesicus fuscus; AL=Scaffold; RT=Major
Sequence
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFIYWTDWGEVPKIERAGMDGSSRFVIINTE
IYWPNGLTLDYEERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVCSLLFILEPLLGSNPCADENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEASKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLS
IDIYSRYIYWTCEATNVITVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEK
NCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGV
IVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_008139078.1.99482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]