SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008147877.1.99482 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008147877.1.99482
Domain Number 1 Region: 16-111
Classification Level Classification E-value
Superfamily EF-hand 4.94e-23
Family Calmodulin-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008147877.1.99482
Sequence length 118
Comment PREDICTED: myosin regulatory light polypeptide 9 isoform X2 [Eptesicus fuscus]; AA=GCF_000308155.1; RF=representative genome; TAX=29078; STAX=29078; NAME=Eptesicus fuscus; AL=Scaffold; RT=Major
Sequence
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
Download sequence
Identical sequences A0A2I2Z2G7 A0A2I3HZN7 A0A2I3M8Z3 A0A2I3RPX4 A0A2J8VJL2 A0A2K5DK40 A0A2K5HE59 A0A2K5LRN8 A0A2K5X924 A0A2K5XH84 A0A2K6E2Q7 A0A2K6KC97 A0A2K6NER1 A0A2K6V5I8 F7GF88
ENSP00000217313 ENSP00000217313 gi|31563524|ref|NP_852667.1| NP_852667.1.87134 NP_852667.1.92137 XP_003253573.1.23891 XP_003983605.1.62641 XP_004585842.1.84141 XP_004630937.1.9945 XP_004698024.1.18182 XP_005146816.1.78019 XP_005244587.1.75256 XP_005428433.1.5688 XP_006742598.1.47382 XP_006875785.1.41390 XP_007057226.1.26238 XP_007447808.1.90284 XP_008147877.1.99482 XP_008489373.1.100939 XP_008932601.1.96775 XP_009071478.1.14518 XP_009471586.1.38621 XP_009563665.1.62272 XP_009575928.1.87690 XP_009636256.1.23211 XP_009868034.1.31609 XP_009936891.1.35112 XP_009948038.1.99599 XP_009979598.1.11325 XP_009998147.1.85724 XP_010159594.1.22856 XP_010304036.1.13389 XP_011784504.1.43180 XP_011827746.1.47321 XP_011827748.1.47321 XP_012420545.1.74151 XP_019314130.1.44245 XP_021048926.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]