SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008171240.1.60341 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008171240.1.60341
Domain Number 1 Region: 29-289
Classification Level Classification E-value
Superfamily YWTD domain 8.24e-56
Family YWTD domain 0.00000208
Further Details:      
 
Domain Number 2 Region: 641-896
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-55
Family YWTD domain 0.000005
Further Details:      
 
Domain Number 3 Region: 340-570
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-50
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 4 Region: 943-1202
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-39
Family YWTD domain 0.0000588
Further Details:      
 
Domain Number 5 Region: 1333-1368
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1295-1331
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 899-944
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000399
Family EGF-type module 0.023
Further Details:      
 
Domain Number 8 Region: 1255-1293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 9 Region: 596-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 294-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 1212-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000174
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008171240.1.60341
Sequence length 1612
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Chrysemys picta bellii]; AA=GCF_000241765.3; RF=representative genome; TAX=8478; STAX=8479; NAME=Chrysemys picta bellii; AL=Chromosome; RT=Major
Sequence
MEAAAPPPLLLLLAAAVLQCHLGSLRASPLLLFANRRDVRLVDAGGVKPESTIVVSGLED
AAAVDFQYSQGIVYWTDVSEEAIKQTYLNQTGNIVQNVIISGLVSPDGLACDWIGKKLYW
TDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSS
TRKIIVNSDIYWPNGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALT
LSGETLYWTDWQTRSIHACDKRTGEKKREILNALYSPMDIQVLSPERQPYFHTPCEENNG
GCSHLCLLSPRDPFYSCACPTGVQLEDDGKTCKAGAEEVLLLARRTDLRRISLDMPDFTD
IILQIDNIRHAIAIDYDPVEGYIYWTDDDVRAIRRAYLDGSGAQTLVTTEINHPDGIAVD
WVARNLYWTDTGTDRIEVTRLNGTSRKILISENLDEPRAIVLNPVMGYMYWTDWGENPKI
ECAYLDGSERRVLVNSSLGWPNGLALDLEEDKLYWGDAKTDKIEVINVDGTMRKTLLEDK
LPHIFGFTLLGDYIYWTDWQRRSIERVHKIRASRDIIIDQLPDLMGLKAASVTKVFGTNP
CAENNGGCSHLCFFTPLETRCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNN
NDVAIPLTGVKEASALDFDVSDNRIYWTDISLKTISRAFMNGSSLEHVIEFGLDYPEGMA
VDWMGKNLYWADTGTNRIEVAHLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKP
RIVRAYMDGTNSITLVDKVGRANDLTIDYADQRLYWTDLDTSMIESSNMLGQEREIIADD
LPHPFGLTQYSDYIYWTDWNLHSIERADKTNGKNRTLIQGHLDFVMDILVFHSSRQDGLN
DCMQNNGHCGQLCLAIPNGYRCGCASHYTLDPNSRNCSSPTSFLLFSQKSAISRMIPDDQ
QSPDIILPVHGLRNVKAIDYDPLDKLIYWVDGRQNIIKRAKDDGTQSFTVMSTPNQSQNP
EKQPHDLSIDIYSHTLYWTCEATNSISVHRLNGEPIGMVLKGDHDKPRAIVVNAERGYMY
FTNMQERAPKIERAALDGTEREVLFSTGLIRPVALVIDNKLGKLFWVDADLKRIESCDLS
GANRVTLEDSNILQPMGLTVLGNHLYWIDRQQQMIERVEKTSGYKRTRIQGRIAHLTGIH
AVEEVDMDEFSAHPCSRDNGGCSHICIAKGDGTPRCSCPDHLVLLQNLLTCGEPPTCSPD
QFTCATGEIDCIPMAWRCDGFPECDDRSDEDSCPICLAAQFQCEKGQCIDARLRCNGEID
CQDKSDEADCNTICLPNQFRCASGQCILIKQQCDSFPDCIDGSDELMCEKNTSSDEPQPH
VSAIGPVIGIILSLLVMGGMYFVCQRVVCQRYAGPNGPFPHEYVSGTPHVPLNFIAPGSS
QHGTFTGISCGKSMISSMSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPS
PATDRSLYNTEMFYSSNIPSTTRSYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYY
IDLNSDSDPYPPPPTPRSQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_008171240.1.60341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]