SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008195623.1.52716 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008195623.1.52716
Domain Number 1 Region: 661-783
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.22e-38
Family Regulator of G-protein signaling, RGS 0.0000758
Further Details:      
 
Domain Number 2 Region: 956-1042
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-24
Family Ras-binding domain, RBD 0.0029
Further Details:      
 
Domain Number 3 Region: 7-93
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-21
Family PDZ domain 0.007
Further Details:      
 
Domain Number 4 Region: 168-257,284-304
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000738
Family Phosphotyrosine-binding domain (PTB) 0.016
Further Details:      
 
Domain Number 5 Region: 900-968
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000064
Family Ras-binding domain, RBD 0.045
Further Details:      
 
Weak hits

Sequence:  XP_008195623.1.52716
Domain Number - Region: 534-590
Classification Level Classification E-value
Superfamily Kinase-associated protein B-like 0.0432
Family Kinase-associated protein B-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008195623.1.52716
Sequence length 1322
Comment PREDICTED: regulator of G-protein signaling loco [Tribolium castaneum]; AA=GCF_000002335.3; RF=representative genome; TAX=7070; STAX=7070; NAME=Tribolium castaneum; strain=Georgia GA2; AL=Chromosome; RT=Major
Sequence
MHPSRRRKKRPNYGIRTVEVLRGSNGFGFTISGQQPCILSCIVANSPADHAGLRAGDFLI
SVNGISVSKITHDAVVNLIGNCVGPIRMTIAENYYSDSSEEELDVSRMMGARKPKYMHKP
RPHRCYKQSPSENTKKHNENIKYNDENSGNLLNISNQMSMEDEAGPVEYKALVGYLGTIE
MPKQLLPNSRLQTVCSCIKKLRQEKRAPTAVLMTIFPTCLTLKNSSNHILAIYPTNRVVY
IGSTADRESRYFGLVTSAVSDMRSTENLKHFQWSEDKKFNNTEPEIEISNSCHVFMIDPK
IVDHSVHAKKADTFKFSCTTDVITGGCLEFPRNALYIVNLVQTMYKLQNNESPKNDEASL
GPLVANSPQPSASSNSDSGIGFRDDCGNISDRILVVEFPTHRPFPIVNATNNRPSGIDAS
SIPLESLDLPLNNEINNKNHDIKSKQLNNLNNIRACGSVNIKNVLGKNDNHFLTKQNNDG
EVYNRLTCRAMPDRPMRVTRGLSPTSSDDNTKVPDSKSSETLSVSEDVDFQSSVDNISTH
SSKSDLKGVFKAPSMFFFENKKLKRQSKMVNSCDNLDKFEENIMNYKLSPKVYGLSKPNH
SCEELNNFDTVEKYGYGSLQELCRWDGQGKMRNIAQSEPDVRMQRNGMECEKNGPKESEG
PAGWASSFEKLLDDPLGLHTFAEFLKKEFSAENIYFWTACERYRRLPAGPARVAEAQRIY
QQHLCVGAPEGVNVDSHGRHCTEQALQEASEALFDQAQKQIFNLMKFDSYPRFLKSSLYK
QSLAGELERPQIDSGLLLQPPTPTKLKKSLSNAEDRRRKSLLPWHRKNRSKSKDRGESEY
CQKRGDIVTSCESVNGKLGGGSDTHSSKSSLTSLDLAITSTQDLSKGSQDETSSTVARGP
LCRVVLSNGSTTVVQIKTTESIQQLVTRLLDKRGIVYSAFEVYTNKHQKALDVTDPSTKL
AGCEVTIEQRVTFKLDLPNKKVISVKSKHTKIIADVLRPILQKYNYNLDQAKVTIGDTEA
VDIHLPVTSIDEKRLRITYCEKTVPATPVIKVNNVKAKLDEITNQVFEDILQEKADSAFL
KAKSDKGSVKSEDWGSEHSSGIFGRFLRRDSGLHDRKKKSLMKLKPPGNSSDDVTGEQVK
KPLIAKWKTGVNKLQVACSESDELVEGLTRAQRSRLEDQRGTEINFELPDFLKDKNSRFF
VENGDLRRNNYENRNIMPKDFNNLTNNNNNNSFTNHNQKLNNLRIYSPNKFSSDESSPSK
SLENTVIENKKDSSKCEPPPLPPKPKIVPIKPPNWGQNGYYKKELGASDKKMYLEQPSSS
FV
Download sequence
Identical sequences D6WPU0
XP_008195623.1.52716 TC009818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]