SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008215460.1.61660 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008215460.1.61660
Domain Number 1 Region: 685-934
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000242
Family Tropomyosin 0.00069
Further Details:      
 
Domain Number 2 Region: 1660-1850
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000105
Family Tropomyosin 0.0016
Further Details:      
 
Domain Number 3 Region: 392-572
Classification Level Classification E-value
Superfamily Tropomyosin 0.000085
Family Tropomyosin 0.005
Further Details:      
 
Weak hits

Sequence:  XP_008215460.1.61660
Domain Number - Region: 557-641
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.000235
Family PspA lactotransferrin-binding region 0.0048
Further Details:      
 
Domain Number - Region: 1424-1633
Classification Level Classification E-value
Superfamily Tropomyosin 0.00981
Family Tropomyosin 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008215460.1.61660
Sequence length 1868
Comment PREDICTED: trichohyalin isoform X6 [Nasonia vitripennis]; AA=GCF_000002325.3; RF=representative genome; TAX=7425; STAX=7425; NAME=Nasonia vitripennis; strain=AsymCX; AL=Chromosome; RT=Major
Sequence
MMQGGRDGYGGGGTRSPRSGRRLGELPTVDRSPSRGYSGGGGGGGSSGYVSGRGSPLGSR
RLRAGTRSGNSSPEGQLYSTGGGGVYGHHTPVHQSLVGLAGSGGIGGASPYYASSLGGAR
DVVDELGSPVLLLEERGRSMSQGAGQHRSRSASRPAGMPGPRYASLDRASVGLLDHEREF
VPIREPLSRSAGRYLEDELYGPPLRSVAQRQSPNPHMLRDGGGYIGELQHQNNDLQRELG
NLKKELELTNQKLGSSMHSIKTFWSPELKKERALRKEESTKYSLINEQLKLLNNENQKQS
MMVRQLEEELRLRMRGPSVEMQQQMEVLYNENEHLTREIAILRDTIKELELRIETQKQTL
QARDESIKKLLEMLQNKGMGKEEERIMFQQMQSMAQKQLDELRTEVQRRDQEILAMSAKM
KTLEEQHQDYQRHIAVLKESLCAKEEHYNMLQADVEEMRQRLEEKNRLIEKKTQQALQAQ
QERNRFNTELTELKDHMDIKDRKINVLQRKIENLEDLLKEKDNQVDMARARLTAMQAHHC
SSEGALSSLEEAIGDKEKQMAQLREQRDRAEQEKQEERELHEREIAEYKMKIHTLESEVE
KLSARVERAQAEKDRLEAKLESSQSELGKSKAELDKAASEVGRSGADWEAAKQRLTRLEL
ENERLRHEVERSQSSYGRAINSTQEMDRIQERAEKSNSELRRAQAELRVTQADNERARAE
VAALQEKVEKSQGEVYRLKARLENAQSEQESLREEYDRAQASVARLHSERDKAVGELEKA
QEELERTQATLGKAQLQQDKLQNMLDKTQTEVDKLQERLEKAQAEIRRMQMEKEKQIYDS
ENLQSQLDKTHGQINRMQKERETIQLEVDRLQDKYEKAQTIMQRLQKERDSFHEEMEKLQ
ERVEFHQSQIAKLQREKENVLSELDLVKDRWEKAHNAQQKLALERDDALTEVDILKDKLE
KAQYTLSKAQEEKENASKEFDKILEKYDRAQSEVYRLQNKIEVMEADKDRLELETEKQQM
LASKSREEARKAQEELARVQELYERAALQLSRTKEHEEKSKDELDRLTVDLDMARERFDK
SQIEMRRLQSEREKLLADNERLSFELERAQSQLAKAQAATDKSQEELGRMQLEIEKMYEK
HDRQQAEVRKAQSEAERLRQEAENAREEVERYAARFGKREESLRMKEEHERLKLECDRLR
DRLEKATAELERSRRTEREFETRSESRMGKYALEQEVERLRERLESREAELKRSQNHAQE
LEQRYHELQLQLERTREEAAKMQQAQERNKQEQERARIEAEKLKDRYDKLKAKADALEAD
NEKLRVEIVRLERLMQTEGKTRSESASIEVERLRASLEKAITARDQVELEAGQLAKELEK
SAQLINQKQEEINQSKKEHERLLTEANLLKEERDAVRTELRRSQQVQQAQGNEEIARLHQ
ELQVAQRERDKMAAILENREKHAEKIEKAKEKLESETKHLEMERDQLVIQLEKSQDMLMN
FQQELNASEAECKKHTDEIRRLQMMQQQRGQQQSAESMVEVQRLTQQVQTLTNQVGALTQ
NLTKERQRAEAAEKRLQEGLSQGQQPQNQQQLEQWQRQLDMEKQRAEQAEKKVQTAERQL
HAHQQQIQQMQQQMQAQAQGQQGQAGANAAEAQRLRQELQKAKEEVQQAVVERERFQAQI
EMLCQELQQSQFALHEANNKLQSSQAKMGVDANQGRQIEEQRRQVEQQRQQVEEKAKNVD
AKARAIDEKERMLQNLDQELKKRKAKMDQLEQQLQKSGGSPDKRLAELQKTLEGAERELE
KAREEAKKSTHETERLLQLVQMSQEEQNSKEKQIRDLQEALKAAQAKLKATAAQQQEAGP
AGFLKSFF
Download sequence
Identical sequences K7IMF2
XP_008215460.1.61660 gi|156537438|ref|XP_001606987.1| 7425.XP_001606987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]