SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008257978.1.1745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_008257978.1.1745
Domain Number - Region: 166-235
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0863
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008257978.1.1745
Sequence length 275
Comment PREDICTED: COP9 signalosome complex subunit 7a isoform X1 [Oryctolagus cuniculus]; AA=GCF_000003625.3; RF=representative genome; TAX=9986; STAX=9986; NAME=Oryctolagus cuniculus; breed=Thorbecke inbred; AL=Chromosome; RT=Major
Sequence
MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDF
ASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEAL
ALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVG
CEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLT
ELREPAAGTNQRQPSKKASKGKGLRGSAKIWSKSN
Download sequence
Identical sequences G1PNK6 G1T0T5 L5M8C3 S7PNF1
ENSMLUP00000012536 ENSOCUP00000009625 XP_002712940.1.1745 XP_005873746.1.60319 XP_005873747.1.60319 XP_005873748.1.60319 XP_005873749.1.60319 XP_006084221.1.53796 XP_006084222.1.53796 XP_006084223.1.53796 XP_006084224.1.53796 XP_006757631.1.95426 XP_006757632.1.95426 XP_006757633.1.95426 XP_006757634.1.95426 XP_006914701.1.64745 XP_008143075.1.99482 XP_008257976.1.1745 XP_008257977.1.1745 XP_008257978.1.1745 XP_011364136.1.92234 XP_011364137.1.92234 XP_011364138.1.92234 XP_015447086.1.64745 XP_015447087.1.64745 XP_016018404.1.101085 XP_016018406.1.101085 XP_016018407.1.101085 XP_016077315.1.3490 XP_016077316.1.3490 XP_019609975.1.88060 XP_019609976.1.88060 XP_019609977.1.88060 ENSOCUP00000009625 9986.ENSOCUP00000009625 ENSMLUP00000012536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]