SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008268465.1.1745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008268465.1.1745
Domain Number 1 Region: 363-770
Classification Level Classification E-value
Superfamily ALDH-like 3.4e-91
Family ALDH-like 0.000000122
Further Details:      
 
Domain Number 2 Region: 71-353
Classification Level Classification E-value
Superfamily Carbamate kinase-like 2.36e-50
Family PyrH-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008268465.1.1745
Sequence length 795
Comment PREDICTED: delta-1-pyrroline-5-carboxylate synthase isoform X1 [Oryctolagus cuniculus]; AA=GCF_000003625.3; RF=representative genome; TAX=9986; STAX=9986; NAME=Oryctolagus cuniculus; breed=Thorbecke inbred; AL=Chromosome; RT=Major
Sequence
MLSQVYHSGFKPFNQRLLPWVQSTAVTRSHRVQPPAVRHVRPWSNIPFITVPLSRAHGKS
FAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAV
AFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQY
SICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNV
ISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTK
SRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAG
PTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRDEILLANKKDMEEAEGRLAA
PLLKRLSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRVAKNLELEQVTVPIGVLLVIF
ESRPDCLPQVAALAIASGNGLLLKGGKEASHSNRILHLLTQEALSIHGVKEAVQLVNTRE
EVEDLCRLDKMIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDAEASVDKVTRL
VRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSE
VKSLRTEYGDLELCIEVVDSVQEAIDHIHKYGSSHTDVIVTENEKTAEFFLQHVDSACVF
WNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHGTL
KYLHENLPVPQRNTN
Download sequence
Identical sequences G1SQ11
9986.ENSOCUP00000005157 ENSOCUP00000005157 ENSOCUP00000005157 ENSOCUP00000027147 XP_008268465.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]