SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008313511.1.100486 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008313511.1.100486
Domain Number 1 Region: 634-889
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-55
Family YWTD domain 0.00000418
Further Details:      
 
Domain Number 2 Region: 22-282
Classification Level Classification E-value
Superfamily YWTD domain 1.07e-53
Family YWTD domain 0.00000278
Further Details:      
 
Domain Number 3 Region: 333-571
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-52
Family YWTD domain 0.00000361
Further Details:      
 
Domain Number 4 Region: 937-1198
Classification Level Classification E-value
Superfamily YWTD domain 1.03e-39
Family YWTD domain 0.0000373
Further Details:      
 
Domain Number 5 Region: 1330-1368
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000107
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 892-939
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000511
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 1249-1287
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 8 Region: 589-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000162
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 9 Region: 1289-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 10 Region: 287-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 1206-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000116
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008313511.1.100486
Sequence length 1620
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Cynoglossus semilaevis]; AA=GCF_000523025.1; RF=representative genome; TAX=244447; STAX=244447; NAME=Cynoglossus semilaevis; AL=Chromosome; RT=Major
Sequence
MGVALRTLLLLCSFCLLVRAVPLLLYANRRDLRLVDAAHEKANATVVVGGLEDAAAVDYV
YSEGLIYWSDVSEEAIKRTVFNLSGASVVQTVVPGLASPDGLACDWLGRKLYWTDSETNR
IEVSELDGSLRKVLFWQELDQPRAIALDPERGYMYWTDWGEIPKIERAGMDGTNRSMIID
KEIYWPNGLTLDYSQQKLYWADAKHNFIHRANLDGSLREVVVKGELPHPFALTLYEDTLF
WTDWNTHSIHSCWKQNGGGQRVVHSDIFSPMDIHVFSAKRQPALNSPCSVNNGGCSHLCL
LSPANSQHTCACPTGVQLLEDGKTCRDGATQVLLLARRTDLRRISLDTPDFTDIILQVED
IRHAIAIDYDPVEGYIYWTDDDVKAIRRSLLDGSDAQFVVTTQVNHPDGIAVDWIARNLY
WTDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPKIERADLDG
LERVVMVNTSLGWPNGLALDYEERKMYWGDAKTDKIEVMNLDGTGRRVLVEDKLHHIFGF
TLLGDFIYWTDWQRRSIERVHKHTAEREFIIDQLPDLMGLKATNVHQWVGTNLCAENNGG
CSHLCLYKPTGVQCGCPIGLELIADMRTCIVPEAFLLFSRHTDIRRISLETNNNNVAIPL
TGVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKN
LYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGKPKIDRAAM
DGTGRITLVADVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGQEREVIADDLPHPFGL
TQYQDYIYWTDWSQRSIERANKTSGQNRTVIQGHLDYVMDILVFHSSRQGGWNACASTNG
HCSHLCLAVPVNSFVCGCPAHFSLNYDNKTCSAPTSFLLFSQKTAINRMVIDEQQSPDII
LPIHGLRNVRAIDYDPLDKQLYWIDSKQNVIRRAQEDGNQSMTVVSNSLVAPSQGLQLYD
LSIDIYSRFIYWTSEVTNVINVTRTDGSRVGVVLRGEHDKPRAIVVNPERGYMYFTNLLE
RSPKIERAALDGTEREVLFFSGLGKPVALAIDNEVGKLFWVDSDLRRIESSDLSGANRIV
IADSNILQPVGLTVFGNHLYWIDKQQQMIERIDKTTREGRTKIQARIAYLSDIHAVHELD
MREYSKHPCTWDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPEQFSCTS
GEVDCIPQAWRCDGYAECDDKSDEDNCPVCSDSEFQCDSRQCIDLSLRCNGEFNCQDRSD
ESKCEGLAVPCPLDQFTCTNGQCIGKHKKCDNNMDCSDNSDELRCFTTEEPPPPANTTIG
SIVAVVMALFVVGAVYFVCQRVLCPQMKEDGETVTNDFVVHGPSSVPLGYVPHPSSLSSS
LPGMSRGKSVIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVR
SQYTLEFGYSSNSPSTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRRVPLKSSTTA
KGYTSDLNYDSEPCPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_008313511.1.100486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]