SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008337840.1.92800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008337840.1.92800
Domain Number 1 Region: 15-362
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 5.61e-113
Family IF2B-like 0.0000000954
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008337840.1.92800
Sequence length 382
Comment PREDICTED: methylthioribose-1-phosphate isomerase-like [Malus domestica]; AA=GCF_000148765.1; RF=representative genome; TAX=3750; STAX=3750; NAME=Malus domestica; cultivar=Golden Delicious; AL=Chromosome; RT=Major
Sequence
MAPHSEFTDGTQAPNSLQAICYKRGSLQLLDQTKLPLQSTYLDIRDSTDGWHAIKDMVVR
GAPAIAIAAALSLAVEIFNLEDFNGTPDEAFSFIVMKLEYLVSSRPTAVNLSDAAAKLKQ
IASAVATTTSDARNVFEAYIEASEIMLKDDVASNKAIGSHGASFIQNLLGNSKNISMLTH
CNTGSLATAGYGTALGVIRSLHTEGVLERAYCTETRPFNQGSRLTAFELVHDNIPATLIA
DSAAAALMKFARVNAVVVGAYRVAANGDTANKIGTYNLAVSAKHHNIPFFVAAPLTSVDL
SLSSGEEIIIEERSPKELLNTHGGLGEQVAAFGISVWNPAFDVTPANLITGIITEKGVIT
KKGTDAFDIKGFVQKEAVQASA
Download sequence
Identical sequences XP_008337840.1.92800 MDP0000441604|PACid:22678821 MDP0000441604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]