SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008379886.1.92800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008379886.1.92800
Domain Number 1 Region: 165-270
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-28
Family B3 DNA binding domain 0.0000254
Further Details:      
 
Domain Number 2 Region: 31-84
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000000000719
Family GCC-box binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008379886.1.92800
Sequence length 314
Comment PREDICTED: AP2/ERF and B3 domain-containing transcription repressor RAV2-like [Malus domestica]; AA=GCF_000148765.1; RF=representative genome; TAX=3750; STAX=3750; NAME=Malus domestica; cultivar=Golden Delicious; AL=Chromosome; RT=Major
Sequence
MDLISCWNASTRDYSTMNQANGASSNKLPSSRYKGVVPQSNGRWGAQIYEKSNRVWLGTF
YDEEEAAKTYDIASLKIRGLDAITQISRNQMKPYECDVTEALFLESHSKAEIVDMLRKHS
YANELEMYKHKLYNGCAACALGLDDGGKRMKCYHDFMDTCSRERELLFEKVATPSDVGRL
NRMVIPKRYAEKHFQVHQSVGFGKGVLLKFEDEVGKLWRFGYCYWSSSQSYVLSKGWIRF
VKEKKLKVGDVVRFERSVGEDKKLFIDCRSRNLDISGIGEIHGTVGDPPATVQDDGVVRL
FGVNISRKPVHCRE
Download sequence
Identical sequences XP_008379886.1.92800 MDP0000223137|PACid:22662915 MDP0000223137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]