SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008386070.1.92800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008386070.1.92800
Domain Number 1 Region: 53-247
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.64e-46
Family Thi4-like 0.0000000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008386070.1.92800
Sequence length 312
Comment PREDICTED: thiamine thiazole synthase, chloroplastic-like [Malus domestica]; AA=GCF_000148765.1; RF=representative genome; TAX=3750; STAX=3750; NAME=Malus domestica; cultivar=Golden Delicious; AL=Chromosome; RT=Major
Sequence
MASMTSTLTSSSLTTKLQKPSLLDSSFHGAPMVRLQPAKAAPASNGGLSVSMSANGLNPS
YNLSAFKFDPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPDVQV
AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIDYDEQDNYVVIKHAALFTSTIM
SKLLARPNVKLFNAVAAEDLIIKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSS
CGHDGPMGATGVKRLRSVGMIESVPGXKALDMNTAKDTIVKLTREIMPGXIVTGMEITEI
NGSPRMVHFYLI
Download sequence
Identical sequences MDP0000626995 XP_008386070.1.92800 MDP0000626995|PACid:22630905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]