SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008575548.1.73410 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008575548.1.73410
Domain Number 1 Region: 520-775
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 219-458
Classification Level Classification E-value
Superfamily YWTD domain 1.27e-49
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 3 Region: 823-1082
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-39
Family YWTD domain 0.0000458
Further Details:      
 
Domain Number 4 Region: 39-168
Classification Level Classification E-value
Superfamily YWTD domain 8.89e-29
Family YWTD domain 0.0000373
Further Details:      
 
Domain Number 5 Region: 777-825
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000045
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1213-1251
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 1134-1174
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000119
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 475-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000145
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 9 Region: 1175-1211
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 171-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000341
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1092-1145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000861
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008575548.1.73410
Sequence length 1501
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Galeopterus variegatus]; AA=GCF_000696425.1; RF=representative genome; TAX=482537; STAX=482537; NAME=Galeopterus variegatus; AL=Scaffold; RT=Major
Sequence
MIRNVSAKSGAVELLFGQWQWLLDGTTEMGPGQQLLGWFMYWTDWGEVPKIERAGMDGSS
RFIIINTEIYWPNGLTLDYEERKLYWADAKLNFIHRSNLDGTNRQAVVKGSLPHPFALTL
FEDTLYWTDWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGG
CSHLCLMSPAKPYYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDI
VLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDW
VARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIE
RAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKI
PHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPC
AEENGGCSHLCLYRPQGPRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNN
NVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAV
DWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPK
IDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDL
PHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNE
CASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPETFLLFSQKSAINRMVIDEQ
QSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNL
EIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIAVNPEKGYMY
FTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLS
GANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIH
AVKELNLQEYRHHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQ
QFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDAN
CQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATN
TVGSVIGVIVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSL
SGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPA
TERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSMAT
AKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDS
S
Download sequence
Identical sequences XP_008575548.1.73410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]