SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008629055.2.15636 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008629055.2.15636
Domain Number 1 Region: 630-885
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 19-278
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-54
Family YWTD domain 0.00000158
Further Details:      
 
Domain Number 3 Region: 328-564
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-50
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 4 Region: 933-1192
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-40
Family YWTD domain 0.0000393
Further Details:      
 
Domain Number 5 Region: 887-935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000268
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1323-1361
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000877
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1245-1283
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 585-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000225
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 9 Region: 1285-1321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 281-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000251
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1202-1255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008629055.2.15636
Sequence length 1514
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Corvus brachyrhynchos]; AA=GCF_000691975.1; RF=representative genome; TAX=85066; STAX=85066; NAME=Corvus brachyrhynchos; AL=Scaffold; RT=Major
Sequence
MLTHLSVCPPVSVPCAAAPLLLYANRRDLRLVDAAHGKENATVIVGGLEDAAAVDFVFLK
GLIYWSDVSEEAIKRTEFNKSGSVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVS
NLDGSLRKVLFWQELDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGSSRSIIVNTDIY
WPNGLTLDYEEQKLYWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWTDW
NTHSILACSKYSGEDLREIHSNIFSPMDIHAFSQKRQPNATNPCGINNGGCSHLCLMSPT
KPSYQCACPTGVKLLENGKTCKDGATALLLLARRTDLRRISLDTPDFTDIVLPLEDIRHA
IAIDFDPLEGYIYWTDDEVRAIRRSFLDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDT
GTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRI
VLVNTSLGWPNGLALDYAESKIYWGDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTLLE
DYIYWTDWQRRSIERVHKRTAEREIIIDQLPDLMGLKATNVHQVIGTNPCAEDNGGCSHL
CLYRPQGLRCACPIGLELISDMRTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVK
EASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWA
DTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSE
RTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLDREIIADDLPHPFGLTQYQ
DYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSH
LCLAVPVGGFVCGCPAHYSLNSDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIH
SLRNVRAIDYDPLDKQLYWIDSRQNIIRKAQEDGSQSLTVVTSPVPNQNLDMQPYDLSID
IYSRYIYWTCEATNVINVTRLDGRPMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERSPK
IERAALDGTEREVLFFSGLSKPIALAIDSQLGKLFWADSDLRRIESSDLSGANRIVLEDS
NILQPVGLTVFENWLYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEY
RQHPCSQDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGEID
CIPVAWRCDGFTECEDHSDEKNCPVCSDSQFQCESGQCIDSALRCNGEANCQDNSDEKNC
EVLCLTDQFRCASGQCIGKSKKCDHNLDCSDSSDEQGCYTTEEPAPQPNNTIGSIIGVIL
TVFVVGAMYFICQRVLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRG
KSVISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEF
GYSSNSPSTHRSYR
Download sequence
Identical sequences XP_008629055.2.15636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]