SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008640263.1.15636 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008640263.1.15636
Domain Number 1 Region: 25-263
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.88e-91
Family Calponin-homology domain, CH-domain 0.000000909
Further Details:      
 
Domain Number 2 Region: 282-403
Classification Level Classification E-value
Superfamily Spectrin repeat 6.81e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 3 Region: 997-1152
Classification Level Classification E-value
Superfamily Spectrin repeat 7.52e-30
Family Spectrin repeat 0.0000235
Further Details:      
 
Domain Number 4 Region: 1525-1681
Classification Level Classification E-value
Superfamily Spectrin repeat 7.86e-30
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 5 Region: 1632-1786
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-30
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 627-730
Classification Level Classification E-value
Superfamily Spectrin repeat 2.28e-28
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 7 Region: 1209-1362
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-28
Family Spectrin repeat 0.00045
Further Details:      
 
Domain Number 8 Region: 1844-1998
Classification Level Classification E-value
Superfamily Spectrin repeat 1.65e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 725-842
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-24
Family Spectrin repeat 0.00034
Further Details:      
 
Domain Number 10 Region: 412-515
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 11 Region: 516-624
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-22
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 12 Region: 1325-1436
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-18
Family Spectrin repeat 0.0008
Further Details:      
 
Domain Number 13 Region: 837-938
Classification Level Classification E-value
Superfamily Spectrin repeat 2.02e-18
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 14 Region: 1979-2064
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000157
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008640263.1.15636
Sequence length 2151
Comment PREDICTED: spectrin beta chain, non-erythrocytic 1 isoform X3 [Corvus brachyrhynchos]; AA=GCF_000691975.1; RF=representative genome; TAX=85066; STAX=85066; NAME=Corvus brachyrhynchos; AL=Scaffold; RT=Major
Sequence
MELQKSTSMPGPLSPGYAAQVPYNYNQLEGRFKQLQDEREAVQKKTFTKWVNSHLARVSC
RITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENM
GSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNV
NIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDP
EDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASD
LLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKM
RANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAM
RETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVAKELETENY
HDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLS
QDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRV
AHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSV
VRLLSKHKAFEDEMSGRSGHFQQAIKEGEDMIAEEHFGSEKIRERIKDIREQWANLEQLS
AIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEI
ASYRPTIDSLHEQAKALPQEHAGSPDVQGRLSGIEERYKEVAELTRLRKQALQDTLALYK
MFSEADACELWIDEKEKWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIAR
QLMHSGHPGEKIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREK
TKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAIL
SRLAEINDVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTL
TEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNEL
HKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDF
MTTMDANEEKINAVVETGRRLVSDGNINSDKIQEKVDSIDDRHRKNREAASELLMRLKDN
RDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLEKIE
KEGMQLIAEKPETEAVVKEKLTGLHQMWDELESTTQTKAQRLFDANKAELFTQSCADLDK
WLNGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEIEELQSQARALSQEGKSTD
EVDGKRLTVEKKFLELLEPLNERKANLLASKEIHQFNRDVEDEILWVGERMPIATSTDHG
HNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITESSPNAEVIQQRLADLKQLWN
LLIEETEKRHKRLEESHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQ
ILEQAVEDYAETVHQLSKTSRTLVADNHPESERISMRQSKVDKLYAGLKDLAEERRGKLD
ERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERV
DTVNHMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAK
EVLGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYA
GDKADDIQKRENEVLEAWKALLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIE
AQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQL
TEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKL
IKRHEAFEKSAATWDERFAALERLTTLELLEVRRQQEEEERKRQPPTPETKAEEDGDSQQ
QWDGTKGEQVSQNGLPSDQESPRVSYRSQTYQNYKNFISRRTANDRSWSGL
Download sequence
Identical sequences XP_008640263.1.15636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]