SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008662362.1.34533 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008662362.1.34533
Domain Number 1 Region: 422-506
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.12e-17
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 157-252,311-338
Classification Level Classification E-value
Superfamily POZ domain 1.94e-17
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008662362.1.34533
Sequence length 624
Comment BTB/POZ domain and ankyrin repeat-containing protein NH5.2 [Zea mays]; AA=GCF_000005005.2; RF=representative genome; TAX=4577; STAX=4577; NAME=Zea mays; cultivar=B73; AL=Chromosome; RT=Major
Sequence
MATPAPPTNCVNQASSSCRTESHAQRASDLSLLHPSLRSLSHTTTVELPRHHRRPVEVAS
LCPPFPSSSSPPSPSLPFPPSNSCFACFPAPSSKTRLLISVLWPSVRPAGPPASSKKACR
SQVFSLYYLSGIASHRIDGATTYGTAHEIMSSEDSLKSLSLDYLNLLINGQAFSDVAFSV
EGRLVHAHRCVLAARSLFFRKLFCGLDPNHPPPPPGARAAAAAAPELVIPVSSIRYEVLV
LVLQFLYSGQASVAAPKSGPLPGCGARGCWHTRCGAAVDLALDTLAAARSFGVEQLALLV
QKQLESMVKEASVDDVMKVLMASRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAK
IEEIRAKSPVPAGAPRSPFLTHHYLPINAASSAADRDHKIRRMRRALDAADIELVKLMVM
GEGLDLDDALAVHYAVQHCGRDVVKALLELGAADVNSRAGPTGKTALHLAAEMVSPDMVS
VLLDHHADPSARTLDGVTPLDVLRGLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMV
TTRDVDAAGDDAGGSDGGGGGNFPRSDADDSLVSLTMNSTLMYQGQEMAAAAVAAGEARK
GNGGGGGGGRGSPSNLYFPNGGFP
Download sequence
Identical sequences GRMZM2G022606_T02|PACid:20873800 XP_008662362.1.34533 GRMZM2G022606_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]