SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008667351.1.34533 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008667351.1.34533
Domain Number 1 Region: 361-464
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.01e-21
Family B3 DNA binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008667351.1.34533
Sequence length 961
Comment uncharacterized protein LOC100216901 isoform X1 [Zea mays]; AA=GCF_000005005.2; RF=representative genome; TAX=4577; STAX=4577; NAME=Zea mays; cultivar=B73; AL=Chromosome; RT=Major
Sequence
MAMAAAAAAATKRCMNPACGAPASVLGAGGDWRKGWPLRSGCFALLCDKCGLAYEQFVFC
DIFHQKESGWRDCSFCGKRLHCGCVASKNSYDLLDSGGVHCVTCMKNSLAQSASGQVVPK
LFPSPINLRFFGKSDELLSSRNFEQPPSLTLDSRNDDIAFVNKSNHLFMVKGIEAGQSSN
ILRQKEIENGSRQIKWEQPTLSFGDMGRPFLTRSQSALESPQCTRRDDNKDPTTDSTSES
FSEACLSMSLGIANNVNRMEATSTAERPVLLSTTAIAEGRELATTLSPFQHAQRARHFLT
RPPRIGEGAAFDPTRDMFPHLRVARPPADGRGRNQLLPRYWPRITDQELQQISGDSNSTI
VPLFEKVLSASDAGRIGRLVLPKACAEAYFPPISQPEGRPLTIQDARGKEWHFQFRFWPN
NNSRMYVLEGVTPCIQSLQLQAGDTVTFSRIDPGGKLVMGFRKATNTVSLPDSQISAIAN
GSLLSETLFSTANENIGVVSGYPGFLHSIKGAADLHPNSLYDHHMNLVDGDVSWNKADKF
GSRPDEGSLQFLQKRSHNIGSKSRRFLIDAEDAMELKLTWEEAQELLRPAPTAKPTVVMI
EDYEFEEYDEPPVFAKRSIFTIRATGEQDQWIQCDDCSKWRRLPLNVIVAPKWTCTDNSW
DSKCCSCSAPEELTPRELQSVLQQYEEMRRRKGSYGLKLNVAEMDASSLDAFATAAVFGE
VGNQGSASVATTTKHPRHRPGCTCIVCIQPPSGKGPKHSPACTCNVCMTVRRRFKTLMMR
KKQRQSEREEAEAGKKIAWVNRDEPEGSSLSRSPQTLDSTRDNSDVTATMLDKVSDVNKQ
GHIDVDLNLHPAAPAVQAAQQQPRPVSMMGLLEVAGRPLDNYMKQNGLTSLVGEQGGGSS
STATVPPPALVESEERTSNEGLVPSASAEREPNAMAVDEAGENQQDKAADDDDDAVAAAA
T
Download sequence
Identical sequences A0A1D6F4E9
GRMZM2G172621_P01 GRMZM2G172621_T01|PACid:20847489 XP_008667351.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]