SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008678833.1.34533 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008678833.1.34533
Domain Number 1 Region: 119-227
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.05e-29
Family B3 DNA binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008678833.1.34533
Sequence length 689
Comment auxin response factor 8 isoform X2 [Zea mays]; AA=GCF_000005005.2; RF=representative genome; TAX=4577; STAX=4577; NAME=Zea mays; cultivar=B73; AL=Chromosome; RT=Major
Sequence
MITFADLTEPAAAGAERCVDRQLWLACAGGMCTVPPVGASVYYFPQGHAEHALGLAGAAD
LSAARVPALVPCRVTAVRYMADPDTDEVFARIRLVPLRGGDADADAGGVEDDAAAADEQE
KPASFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYAADPPVQTVVAKDVHGAAWKFRHI
YRGTPRRHLLTTGWSTFVNQKKLVAGDSIVFLRGDSGDLHVGIRRAKRGFCGAGGGGGDD
SPAAGWDHYAGLMRGNVSPCAAAKARGKVRPEDVAEAARLAAAGQSFEVVYYPRASTPEF
CVRAAAVRVAMRVQWSPGMRFKMAFETEDSSRISWFMGTVAGVQVTDPIRWPQSPWRLLQ
VTWDEPDLLQNVKRVSPWLVELVSSMPAIHLASFSPPRKKPRIPAYPEFPFEGQLLNPAF
PPNPLPHGQHHHHFLHSHSHQHHHPPFFPFPAGSAPAAIQGARHAQFVPPFSELHLTHLQ
PSLLYPRLRRPDHVGPTTPIPARVSTDLTIGGAAAAARDDDDDDFPCAPPSTGANRQKPD
AKPAGLVLFGRTILTEQQMSRSGATSPAATGNSSTCWNAEKGPNASEGSGGSGVIQTSPA
KAASSERPPWLGGDGSQQQQASGELGLGLEPGQCKVFVESDTVGRNLDLAALRSFDELYG
RLSGMFGVAGAELRSRVLYRGAAGDEPFR
Download sequence
Identical sequences GRMZM2G081406_P01 XP_008678833.1.34533 GRMZM2G081406_T01|PACid:20861329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]