SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008705211.1.72690 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008705211.1.72690
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 180-419
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-49
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 3 Region: 784-1043
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-39
Family YWTD domain 0.0000427
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-28
Family YWTD domain 0.0000407
Further Details:      
 
Domain Number 5 Region: 738-785
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000524
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1174-1212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 436-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000995
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1095-1135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000011
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1136-1172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 132-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000598
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1053-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000271
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008705211.1.72690
Sequence length 1397
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X2 [Ursus maritimus]; AA=GCF_000687225.1; RF=representative genome; TAX=29073; STAX=29073; NAME=Ursus maritimus; AL=Scaffold; RT=Major
Sequence
MYWTDWGEVPKIERAGMDGSSRFIIINTEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNL
DGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKYTGEGLREIHSNIFSPMDI
HAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELL
LLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDG
SGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAI
VLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKT
DKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREIIIDQ
LPDLMGLKATNVHRIIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPR
ALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLD
TNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG
HLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSA
PTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRK
AQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSIGVV
LKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDS
RLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKID
MTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCP
MHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSES
QFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCSNGQCIGKHKKCDHNVDC
SDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQRMLCPRMKGDGETMTN
DYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSS
SSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSTHFSPRNASYIYCKN
VVEDVGSTAHDPISEDI
Download sequence
Identical sequences XP_008705210.1.72690 XP_008705211.1.72690 XP_008705212.1.72690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]