SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008764788.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008764788.1.100692
Domain Number 1 Region: 21-75,223-361,398-444
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.92e-72
Family Inositol polyphosphate kinase (IPK) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008764788.1.100692
Sequence length 448
Comment PREDICTED: inositol hexakisphosphate kinase 2 isoform X2 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MSPAFRTMDVEPRTKGILLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMR
RFTPQYKAVLIFVRFADEFGASGNIETKEQGVVSVRFEEDEDRNLCLIAYPLKGDHGPVD
IVDNSDCEPKSKLLRWTNKKHHVLETEKSPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEV
LYYSVEKKGTVSSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLTCRYEVPCV
LDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGTGQLMFMNKYHGR
KLSVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGK
EWPEVTLDSDAEDLEDLSEESADESAGAYAYKPLGASSVDVRMIDFAHTTCRLYGEDSVV
HEGQDAGYIFGLQSLIDIVTEISEESGE
Download sequence
Identical sequences XP_008764788.1.100692 ENSRNOP00000030776 10116.ENSRNOP00000039425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]