SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008765877.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008765877.1.100692
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily MAPEG domain-like 2.09e-41
Family MAPEG domain 0.000000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008765877.1.100692
Sequence length 150
Comment PREDICTED: leukotriene C4 synthase isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MKEETALLATVTLLGVLLQAYFSLQVISARRTFHVSPPLTSGPPEFERVFRAQVNCSEYF
PLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQHRLDPLYASARALWLLVA
MAALGLLVHFLPGTLRAALFRWLQVLLPMA
Download sequence
Identical sequences G3V6E6
ENSRNOP00000004359 XP_008765877.1.100692 ENSRNOP00000004359 10116.ENSRNOP00000004359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]