SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008918185.1.96775 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008918185.1.96775
Domain Number 1 Region: 5-265
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-55
Family YWTD domain 0.00000217
Further Details:      
 
Domain Number 2 Region: 617-872
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-55
Family YWTD domain 0.00000493
Further Details:      
 
Domain Number 3 Region: 316-546
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-50
Family YWTD domain 0.00000234
Further Details:      
 
Domain Number 4 Region: 919-1178
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-39
Family YWTD domain 0.0000588
Further Details:      
 
Domain Number 5 Region: 1309-1345
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1271-1306
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1230-1270
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 8 Region: 572-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000357
Family EGF-type module 0.013
Further Details:      
 
Domain Number 9 Region: 875-920
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000367
Family EGF-type module 0.039
Further Details:      
 
Domain Number 10 Region: 270-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1187-1240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008918185.1.96775
Sequence length 1586
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Manacus vitellinus]; AA=GCF_000692015.1; RF=na; TAX=328815; STAX=328815; NAME=Manacus vitellinus; AL=Scaffold; RT=Major
Sequence
MRTSPLLLFANRRDVRLVDAGGTKLESTVVVSGLEDAAAVDFQYSQGIVFWTDVSEEAIK
QTYINQTGNVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEVANLNGTSRKVLFWQ
DLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSMRKIIVDSDIYWPNGLTIDLDEQK
LYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTG
EKRREILSALYSPMDIQVLSPDRQPYFHTPCEENNGGCSHLCLLSPRDPFYSCACPTGVQ
LEDDGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIILQIDNIRHAIAIDYDPVEGYIY
WTDDDVRAIRRAYLDGAGAQTLVTTEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGT
SRKILISENLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSERRVLVNTSLGWPNGL
ALDLEKNKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSI
ERVHKIKASRDIIIDQLPDLMGLKATSVTKVFGTNSCAENNGGCSHLCFFTPQETRCACP
IGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSDNR
IYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLD
GQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAFMDGTNSITLVDKVGRAND
LTIDYVDQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDYIYWTDWNLHSI
ERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLCLAIPNGFRCGC
AAHYTLDPNSRNCSSPASFLLFSQKSAISRMIPDDQQSPDIILPMHGLRNVKAIDYDPLD
KLIYWVDGRQNIIKRAKDDGTQPFTVMSTPNQSQNPEKQPHDLSIDIYSHTLYWTCEATN
SVNVHRLNGESIGMVLRGDHDRPRAIVVNAERGYMYFTNMQERAPKIERAALDGTEREVL
FTTGLIRPVALVVDNKLGKLFWVDADLKRIESCDLSGANRVTLEDSNILQPMGLTVLGNH
LYWIDRQQQMIERVEKVNGYKRTRIQGRIAHLTGIHAVEELDMEEFSVHPCSRDNGGCSH
ICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRCDGFPEC
DDQSDEDSCPICSASQFQCEKGQCIDAHLRCNGEIDCQDKSDEADCDTICLPNQFRCASG
QCILLKQQCDSFPDCIDGSDELICVPTSDESQPHSSAIGPVIGIILSLFVMGGMYFVCQR
VVCQRYAGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTGISCGKSMISSMSLMGGSSG
APLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSLYNAEMFYSSNIPSNTRSYR
PYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDSDPYPPPPTPRSQYMSAEES
CPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_008918185.1.96775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]