SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008942015.1.37566 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008942015.1.37566
Domain Number 1 Region: 416-671
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 115-350
Classification Level Classification E-value
Superfamily YWTD domain 1.07e-49
Family YWTD domain 0.00000346
Further Details:      
 
Domain Number 3 Region: 719-978
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-40
Family YWTD domain 0.0000373
Further Details:      
 
Domain Number 4 Region: 673-721
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000272
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 1109-1147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000746
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 1031-1069
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1071-1107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 67-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000229
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 9 Region: 8-64
Classification Level Classification E-value
Superfamily YWTD domain 0.000000366
Family YWTD domain 0.0019
Further Details:      
 
Domain Number 10 Region: 379-417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000838
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 11 Region: 988-1041
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000849
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008942015.1.37566
Sequence length 1300
Comment PREDICTED: low-density lipoprotein receptor-related protein 6, partial [Merops nubicus]; AA=GCF_000691845.1; RF=representative genome; TAX=57421; STAX=57421; NAME=Merops nubicus; AL=Scaffold; RT=Major
Sequence
QAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYSGEDLREVHSNIFSPMDIHAFSQ
KRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTGVKLLENGKTCKDGATELLLLARR
TDLRRISLDPPDFTDIVLPLEDIRHAIAIDFDPLEGYIYWTDDEVRAIRRAGLDGAGSQV
VVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPM
VGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNGLALDYAESKIYWGDAKTDKIEV
MNADGTGRRVLVEDKLPHIFGFTLLGDYVYWTDWQRRSIERVHKRTAEREIIIDQLPDLM
GLKATNVHQIMGTTPWAEENGGCSHLCLYRPQGLRCACPIGLELISDMRTCIVPEAFLLF
SRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSAL
EHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALD
PAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIE
SSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYV
MDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNSDNRTCSAPTTFL
LFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNIIRKAQEDG
SQSLTVVTSPVPNQNLEMQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRPMGVVLRGDQ
DRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPVALAIDSQLGKL
FWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDRQQQMIEKIDMTGRE
GRTKVQARIAQLSDIHAVKELNLQEYRQHPCSQDNGGCSHICIVKGDGTTRCSCPVHLVL
LQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDEKNCPVCSDSQFQCE
SGQCIDSALRCNGEANCQDNSDEKNCEVLCLTDQFRCASGQCIGKSKKCDHNLDCSDSSD
EQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGAMYFICQRVLCPRMKGDGETMTNDYVVH
GPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASSSSSSST
KGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYR
Download sequence
Identical sequences XP_008942015.1.37566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]