SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008976008.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008976008.1.60992
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.87e-94
Family Calponin-homology domain, CH-domain 0.00000298
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-34
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 3 Region: 601-741
Classification Level Classification E-value
Superfamily Spectrin repeat 8.86e-29
Family Spectrin repeat 0.00034
Further Details:      
 
Domain Number 4 Region: 1851-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 2.68e-27
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 5 Region: 1533-1687
Classification Level Classification E-value
Superfamily Spectrin repeat 3.34e-27
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 1010-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 5.11e-27
Family Spectrin repeat 0.00000138
Further Details:      
 
Domain Number 7 Region: 815-950
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-25
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 8 Region: 1228-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-24
Family Spectrin repeat 0.00077
Further Details:      
 
Domain Number 9 Region: 1690-1797
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-22
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 10 Region: 425-526
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-22
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 11 Region: 2172-2259
Classification Level Classification E-value
Superfamily PH domain-like 5.24e-21
Family Pleckstrin-homology domain (PH domain) 0.0000717
Further Details:      
 
Domain Number 12 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-19
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 13 Region: 529-635
Classification Level Classification E-value
Superfamily Spectrin repeat 1.04e-18
Family Spectrin repeat 0.00066
Further Details:      
 
Domain Number 14 Region: 1352-1450
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000366
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 15 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000173
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008976008.1.60992
Sequence length 2268
Comment PREDICTED: spectrin beta chain, erythrocytic isoform X2 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MTSATEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVETQEGRETRSAKDALL
LWCQMKTAGYPHVNITNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIRQEKL
EQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRA
LEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLQSRRQRLETTLALQKLFQDMLHS
INWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLKFTEGKGY
QPCDPQVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLEQIFQEAHDMVARKQFGHPHIEARIKE
VSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRA
LGKKHKDFLEELEESRGVMEHLEQQAQGFPEEFRDSPDVTHRLQALRELYQQVVAQADLR
QQRLQEALDLYTVFGETDACELWMGEKEKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTL
MTQIDGVNLAANSLVESGHPRSREVKQYQDHLNTRWQAFQTLVSERREAVDSALRVHNYC
VDCEETSKWITDKTKVVESTKDLGQDLAGIIAIQRKLSGLERDVAAIQARVDALERESQQ
LMDSHPEQKEDIGQRQKHLEELWQGLQQSLQGQEDLLGEVSQLQAFLQDLDDFQAWLSIT
QKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDSYQRVKESGEKVIQGQMDPEYLLLG
QRLEGLDTGWDALGRMWESRSHTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSL
EAAEAGIRKFEDFLGSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHRKNN
EKAQEASVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVA
ELASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALHRLWDELQATTKEKTQHLSAARS
SDLRLQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELGELFA
QVPSMGEEGGDADLSIEKRFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLPL
AQSADYGTNLQTVQLFMKKNQTLQNEILGHTPRVEDVLQRGQQLVEAAEIDCQDLEERLA
HLQSSWDRLREAAAGRLQRLRDANEAQQYYLDADEAEAWIGEQELYVISDEIPKDEEGAI
VMLKRHLRQQRAVEDYGRNIKQLASRAQGLLSAGHPEGEQIIRLQGQVDKHYAGLKDVAE
ERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDHVTLLRDKFRDFARETG
AIGQERVDNVNAFIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLH
RYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVAT
RLQTAYAGEKAEAIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWME
SIIRQIETQERPRDVSSVELLMKYHQGINAEIETRSKNFSACLELGESLLQRQHQASEEI
REKLQQVMSRRKEMNEKWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHT
VDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQIAERPAEETGPQEEEGETAG
EAPVSHHAATERTSPGEEEGTWPQNLQQPPLPGQHKDGQKSTGDERPATEPLFKVLDTPL
SEGDEPATLLAPRDHGQSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSELTFYKD
AKNLALGMPYHGEEPLALRHAICEIAANYKKKKHVFKLRRRCCPGCRA
Download sequence
Identical sequences XP_008976008.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]