SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008981684.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008981684.1.60252
Domain Number 1 Region: 75-135
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.97e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008981684.1.60252
Sequence length 189
Comment PREDICTED: class A basic helix-loop-helix protein 15 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MKTKNRPPRRRAPVQDTEATPGQGTPDGPLPSPGPEPAKSLRSRPARAAAGPRGEGGRRR
PGPSGPGGRRDSSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLA
KNYIKSLTATILTMSSSRLPGLEGPGPKLYQHYQQQQQAAGGTLGTTEAQPQGHLQKYST
QIHSFREGT
Download sequence
Identical sequences F7DV83
ENSCJAP00000041618 ENSCJAP00000041618 XP_008981684.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]