SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008998006.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008998006.1.60252
Domain Number 1 Region: 31-512
Classification Level Classification E-value
Superfamily ALDH-like 8.51e-182
Family ALDH-like 0.00000000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008998006.1.60252
Sequence length 517
Comment PREDICTED: aldehyde dehydrogenase X, mitochondrial [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MLRFLAPRLLCLQVRTAQYSSAAALPSPIPNPDIRYNQLFINNEWHDAVSKKTFPTVNPS
TGELIGHVAEGDRADVDRAVKAAREAFRLGSPWRQMDASERGRLLNRLADLVERDRVYLA
SLETLDNEKPFQSXXXXXXDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCG
QIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITG
YGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADM
EHAVEQCHEALFFNMGQCCCAGSRTFVEASIYNEFLERTVEKAKQRKVGNPFELDTQQGP
QVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP
VQPLFKFKKIEEVIERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHT
PFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS
Download sequence
Identical sequences F6T260
ENSCJAP00000019665 ENSCJAP00000019674 XP_008998006.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]