SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009231930.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009231930.1.23681
Domain Number 1 Region: 541-666
Classification Level Classification E-value
Superfamily PH domain-like 5.89e-19
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 2 Region: 84-266
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000128
Family Clathrin adaptor core protein 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009231930.1.23681
Sequence length 720
Comment PREDICTED: engulfment and cell motility protein 2 isoform X1 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MPPPSDIVKVAIEWPGANAQLLEIDQKRPLASIIKEVCDGWSLPNPEYYTLRYADGPQLY
ITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSADVTFATEF
INMDGIIVLTRLVESGTKLLSHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYV
SQPMVDVSILQRSLAILESMVLNSQSLYQKIAEEITVGQLISHLQVSNQEIQTYAIALIN
ALFLKAPEDKRQDMANAFAQKHLRSIILNHVIRGNRPIKTEMAHQLYVLQVLTFNLLEER
MMTKMDPNDQAQRDIIFELRRIAFDAESDPSNAPGSGTEKRKAMYTKDYKMLGFTNHINP
AMDFTQTPPGMLALDNMLYLAKVHQDTYIRIVLENSSREDKHECPFGRSAIELTKMLCEI
LQVGELPNEGRNDYHPMFFTHDRAFEELFGICIQLLNKTWKEMRATAEDFNKVMQVVREQ
ITRALPSKPNSLDQFKSKLRSLSYSEILRLRQSERMSQDDFQSPPIVELREKIQPEILEL
IKQQRLNRLCEGSSFRKIGNRRRQERFWYCRLALNHKVLHYGDLDDNPQGEVTFESLQEK
IPVADIKAIVTGKDCPHMKEKSALKQNKEVLELAFSILYDPDETLNFIAPNKYEYCIWID
GLSALLGKDMSSELTKSDLDTLLSMEMKLRLLDLENIQIPEAPPPIPKEPSSYDFVYHYG
Download sequence
Identical sequences A0A2I3RQT1 G3RDW1 H2P264 Q96JJ3
ENSPTRP00000023348 9598.ENSPTRP00000023348 9600.ENSPPYP00000012394 9606.ENSP00000290246 ENSPTRP00000023348 HR5379 ENSP00000290246 ENSP00000379673 ENSPPYP00000012394 ENSP00000290246 ENSP00000379673 gi|19718769|ref|NP_573403.1| gi|33469947|ref|NP_877496.1| NP_573403.1.87134 NP_573403.1.92137 NP_877496.1.87134 NP_877496.1.92137 XP_003826049.1.60992 XP_003826050.1.60992 XP_005260553.1.92137 XP_006723917.1.92137 XP_009231929.1.23681 XP_009231930.1.23681 XP_009231931.1.23681 XP_009231933.1.23681 XP_009231934.1.23681 XP_009231935.1.23681 XP_009435606.1.37143 XP_018872923.1.27298 XP_514693.2.37143 ENSPPYP00000012394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]