SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009296461.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009296461.1.45394
Domain Number 1 Region: 4-124
Classification Level Classification E-value
Superfamily Histone-fold 4.34e-48
Family Nucleosome core histones 0.0000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009296461.1.45394
Sequence length 128
Comment histone H2A-like [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TEKATKGK
Download sequence
Identical sequences E7F5W3
XP_009296461.1.45394 XP_693579.2.45394 ENSDARP00000090632 ENSDARP00000105290 7955.ENSDARP00000098527 ENSDARP00000090632 ENSDARP00000105290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]