SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009296490.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009296490.1.45394
Domain Number 1 Region: 4-125
Classification Level Classification E-value
Superfamily Histone-fold 3.89e-48
Family Nucleosome core histones 0.00000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009296490.1.45394
Sequence length 128
Comment histone H2A [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TEKAAKGK
Download sequence
Identical sequences E7EXD7
XP_002666988.1.45394 XP_009296467.1.45394 XP_009296490.1.45394 XP_009301954.1.45394 XP_689030.3.45394 XP_698647.2.45394 ENSDARP00000093787 ENSDARP00000098726 ENSDARP00000102749 ENSDARP00000103819 ENSDARP00000104630 ENSDARP00000110869 7955.ENSDARP00000093787 7955.ENSDARP00000098726 7955.ENSDARP00000101879 7955.ENSDARP00000103819 ENSDARP00000093787 ENSDARP00000098726 ENSDARP00000102749 ENSDARP00000103819 ENSDARP00000104630 ENSDARP00000110869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]