SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009300647.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009300647.1.45394
Domain Number 1 Region: 9-140
Classification Level Classification E-value
Superfamily Histone-fold 1.06e-40
Family TBP-associated factors, TAFs 0.000000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009300647.1.45394
Sequence length 176
Comment protein Dr1 isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLVSSEANEICNK
SEKKTISPEHVINALESLGFGSYIAEVKDVLQECKTVALKRRKASSRLENLGIPEEELLR
QQQELFAKARQQQAELAQQEWLQMQQAAQQAQLAAASASSTQQAGSSQDEDEEDDM
Download sequence
Identical sequences Q08BR1
NP_001070782.1.45394 XP_009300647.1.45394 7955.ENSDARP00000077836 ENSDARP00000077836 ENSDARP00000109791 ENSDARP00000110539 ENSDARP00000126013 ENSDARP00000077836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]