SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009304584.2.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009304584.2.45394
Domain Number 1 Region: 41-272
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.8e-32
Family Hypothetical protein cg14615-pa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009304584.2.45394
Sequence length 284
Comment glycine N-acyltransferase-like protein 3 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MIILTSEELKQAESVLKNFFPESIKVYGCIFNINRGKPHNLEVIADLWPEFTVIICKPKV
QGVKNREGDFNIYSIYSKSKDSLKSFLDTPGVINKDAFTLLAGVDIRHLGAVQEFADQHG
IPSKVQGVMNVLVLQDQQQLQFKDRHAGLSFAPLSTAHAHLVNSTWKYGGDSSSYNSVLN
YISHNPSLCVIEEGQTEPVSWLLVYPHAALGLLYTLPQHRCKGYARLLVSIMSKNLLEQG
HPVYCFVEEENKPSYKLFTSLGFQNSPDYRAVWFELNKQQVRDE
Download sequence
Identical sequences ENSDARP00000068164 XP_009304583.2.45394 XP_009304584.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]