SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009305372.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009305372.1.45394
Domain Number 1 Region: 176-363
Classification Level Classification E-value
Superfamily Macro domain-like 4.21e-48
Family Macro domain 0.000000143
Further Details:      
 
Domain Number 2 Region: 13-117
Classification Level Classification E-value
Superfamily Histone-fold 1.5e-38
Family Nucleosome core histones 0.0000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009305372.1.45394
Sequence length 367
Comment H2A histone family, member Y-like isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MSARGGKKKITKLSRSARAGVIFPVGRMMRYLRTGTHKYRIGMGAPVYMAAVIEYLAAEI
LELAGNAARDNKKGRITPRHIKLAVANDEELNQLLRGVTISNGGVLPRIHPELLSKKRGG
KVKVESQVAVPEKSAKRKPVKKPYKKSKGKPGRKPKKSTENDKEADANAMEDGPGEGFTI
LSAKSLFLGQKLSLTESEISKIGTIKVEGIINPTNAEIDLKEGIGNALEKTGGKDFLETV
KELRKSQGPLEVASVAVSQANGMAARFIIHCHVPQWGSDKCEDQLEKTVKNCLSAAEEKK
LKSVAFPSLPAGRNGFPKQTAAQLILKAISNHFVSATTSSLKNIYFVLFDSESIGIYLQE
MAKMDAK
Download sequence
Identical sequences D4P8I2 Q4V914
NP_001020673.1.45394 XP_009305372.1.45394 7955.ENSDARP00000058161 ENSDARP00000058161 ENSDARP00000105230 ENSDARP00000058161 ENSDARP00000105230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]